CATH Domain: 2ywwB02 XML data for domain: 2ywwB02

Molscript image for 2ywwB02
2ywwB02
PDB coordinates for domain 2ywwB02

PDB 2yww, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.20 Gene3D
2.30.30.20.2
2.30.30.20.2.1
2.30.30.20.2.1.1
2.30.30.20.2.1.1.1
2.30.30.20.2.1.1.1.1

[top]
Segment boundaries for domain 2ywwB02

Chopping figure for domain 2ywwB02
DomainStart PDB ResidueStop PDB Residue
2ywwB01 8 98
2ywwB02 99 149

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 2.30.30.20.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1l1oC02 80.08 Replication factor A1DNA-dependent DNA replicationDNA replicationNucleotide excision repairReplication protein A 70 kDa DNA-binding subunit 2.20.25.10 38 13 72 2.76 3.80
1mhnA00 76.68 Survival motor neuron proteinSurvival motor neuron proteinHomo sapiensProtein binding 2.30.30.140 59 7 71 3.42 4.80
1tfiA00 76.01 Transcription from RNA polymerase II promoterTranscription elongation factor S-IITranscription elongation factor A protein 1General RNA polymerase II transcription factor activityHomo sapiens 2.20.25.10 50 8 80 3.78 4.70
1igqB00 75.21 Escherichia coliTranscriptional repressor protein korB 2.30.30.150 57 0 63 2.72 4.31
1o6wA02 72.77 U2-type prespliceosomeRNA bindingPre-mRNA-processing factor 40Protein bindingNuclear mRNA splicing, via spliceosome 2.20.70.10 33 3 54 2.44 4.44
2heqA01 71.22 Bacillus subtilisSPBc2 prophage-derived uncharacterized protein yorP 2.30.30.40 54 9 85 4.14 4.86
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ywwB02
PDEIEGTLKCTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIFE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ywwB02
PDEIEGTLKCTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIFE
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Dec 2007 22:13

Assigning to "2.30.30.20" based on similarity with "1pg5B02"

Flow stage update by auto on 01 Dec 2007 22:04

No in_process hits for Domain "2ywwB02" ready to be processed

Flow stage update by auto on 01 Dec 2007 22:04

NW result present for Domain "2ywwB02"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2ywwB02"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2ywwB02"

Insertion by auto on 23 Nov 2007 18:47

Final ChopClose added based on similarity with "1pg5B"