Domain assigned by auto on 02 Dec 2007 02:57
Assigning to "3.30.470.20" based on similarity with "2ywvB02"
CATH Domain: 2ywvA02
2ywvA02
PDB 2ywv, Chain A, Domain 2
Segment boundaries for domain 2ywvA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2ywvA01 | 1 | 85 |
| 2ywvA01 | 223 | 237 |
| 2ywvA02 | 86 | 222 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2ywvA02 TIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRL HFAERNVRLIDFKLEFGRTADGAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGS
Domain History Events (9)
Flow stage update by auto on 02 Dec 2007 02:57
No in_process hits for Domain "2ywvA02" ready to be processed
Update comment by auto on 02 Dec 2007 02:31
Domain "2ywvA02" hits Domain "2z02B02" (55.4744525547445% over 100%) which is currently in process
Update comment by auto on 01 Dec 2007 22:13
Domain "2ywvA02" hits Domain "2ywvB02" (100% over 100%) which is currently in process
Flow stage update by auto on 01 Dec 2007 22:04
Domain "2ywvA02" hits Domain "2ywvB02" (100% over 100%) which is currently in process
Flow stage update by auto on 01 Dec 2007 22:04
NW result present for Domain "2ywvA02"
Flow stage update by auto on 24 Nov 2007 14:38
All required files are present for Domain "2ywvA02"
Flow stage update by auto on 24 Nov 2007 02:37
Beginning processing for Domain "2ywvA02"
Insertion by auto on 23 Nov 2007 18:15
Final ChopClose added based on similarity with "2ywvB"
