CATH Domain: 2yw2A02 XML data for domain: 2yw2A02

Molscript image for 2yw2A02
2yw2A02
PDB coordinates for domain 2yw2A02

PDB 2yw2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.3
3.30.1490.20.3.1
3.30.1490.20.3.1.1
3.30.1490.20.3.1.1.1
3.30.1490.20.3.1.1.1.1

[top]
Segment boundaries for domain 2yw2A02

Chopping figure for domain 2yw2A02
DomainStart PDB ResidueStop PDB Residue
2yw2A01 2 93
2yw2A02 119 188
2yw2A03 189 324
2yw2A04 325 420

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vkzA02 89.71 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.1490.20 70 37 100 2.09 2.09
1bxrA07 87.24 3.30.1490.20 70 17 94 2.79 2.96
1ehiA03 86.73 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 20 87 2.00 2.30
1w96A03 86.25 Endoplasmic reticulum membraneAcetyl-CoA carboxylaseProtein import into nucleusBiotin carboxylase [EC:6.3.4.14]Nuclear envelope organization 3.30.1490.20 63 23 90 2.44 2.71
1gsaA03 86.18 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingCytosol 3.30.1490.20 65 12 91 2.94 3.22
2nu8B02 86.01 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 21 83 2.62 3.14
1iowA03 85.53 D-Alanine metabolismPeptidoglycan biosynthesisD-alanine--D-alanine ligase BD-alanine-D-alanine ligase [EC:6.3.2.4]Escherichia coli K-12 3.30.1490.20 73 21 87 2.91 3.32
1i7nA01 84.91 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 16 85 2.16 2.52
3g8dB03 83.57 Pyruvate metabolismFatty acid biosynthesisPropanoate metabolismMetabolic pathwaysFatty acid biosynthetic process 3.30.1490.20 73 17 94 3.33 3.52
3ethA03 82.32 Purine metabolismMetabolic pathways5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]Phosphoribosylaminoimidazole carboxylase ATPase subunitEscherichia coli K-12 3.30.1490.20 62 8 78 2.43 3.09
1m0wB05 79.90 Glutathione synthase [EC:6.3.2.3]Glutathione bindingProtein homodimerization activityGlutathione metabolismMetabolic pathways 3.30.1490.50 60 13 81 3.41 4.19
2r6fA03 78.85 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 7 80 3.17 3.96
3kalA05 78.26 Homoglutathione synthetaseGlycine max 3.30.1490.50 61 9 81 3.91 4.80
1fviA01 77.20 Paramecium bursaria Chlorella virus 1A544R protein 3.30.1490.70 79 14 67 3.33 4.96
3l4jA02 76.80 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.1490.30 47 6 60 2.63 4.38
2pbzA03 72.28 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC:6.3.4.-]Purine metabolismThermococcus kodakarensisMetabolic pathwaysPutative uncharacterized protein 3.30.1490.20 38 7 47 2.30 4.88
1x9nA02 71.79 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 5 66 3.24 4.89
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2yw2A02
RYEVFTDFEKAKEYVEKVGAPIVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2yw2A02
RYEVFTDFEKAKEYVEKVGAPIVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFL
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 01 Dec 2007 18:38

Assigning to "3.30.1490.20" based on similarity with "2yrwA02"

Flow stage update by auto on 01 Dec 2007 18:38

No in_process hits for Domain "2yw2A02" ready to be processed

Update comment by auto on 01 Dec 2007 18:34

Domain "2yw2A02" hits Domain "2yrwA02" (51.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 18:31

Domain "2yw2A02" hits Domain "2ys7A02" (51.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 18:25

Domain "2yw2A02" hits Domain "2yrxA02" (51.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 18:14

Domain "2yw2A02" hits Domain "2ys6A02" (51.4285714285714% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2007 18:04

Domain "2yw2A02" hits Domain "2ys6A02" (51.4285714285714% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2007 18:04

NW result present for Domain "2yw2A02"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2yw2A02"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2yw2A02"

Insertion by auto on 23 Nov 2007 19:57

Final ChopClose added based on similarity with "1gsoA"