Domain assigned by auto on 01 Dec 2007 18:38
Assigning to "3.30.1490.20" based on similarity with "2yrwA02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2yw2A01 | 2 | 93 |
| 2yw2A02 | 119 | 188 |
| 2yw2A03 | 189 | 324 |
| 2yw2A04 | 325 | 420 |
There are 17 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.3.1.1.1.1 (SIMAX score < 5)
>pdb|2yw2A02 RYEVFTDFEKAKEYVEKVGAPIVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFL
Assigning to "3.30.1490.20" based on similarity with "2yrwA02"
No in_process hits for Domain "2yw2A02" ready to be processed
Domain "2yw2A02" hits Domain "2yrwA02" (51.4285714285714% over 100%) which is currently in process
Domain "2yw2A02" hits Domain "2ys7A02" (51.4285714285714% over 100%) which is currently in process
Domain "2yw2A02" hits Domain "2yrxA02" (51.4285714285714% over 100%) which is currently in process
Domain "2yw2A02" hits Domain "2ys6A02" (51.4285714285714% over 100%) which is currently in process
Domain "2yw2A02" hits Domain "2ys6A02" (51.4285714285714% over 100%) which is currently in process
NW result present for Domain "2yw2A02"
All required files are present for Domain "2yw2A02"
Beginning processing for Domain "2yw2A02"
Final ChopClose added based on similarity with "1gsoA"