CATH Domain: 2vs7A02 XML data for domain: 2vs7A02

Molscript image for 2vs7A02
2vs7A02
PDB coordinates for domain 2vs7A02

PDB 2vs7, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.28 Endonuclease I-creI
3.10.28.10 Homing endonucleases Gene3D
3.10.28.10.13
3.10.28.10.13.1
3.10.28.10.13.1.1
3.10.28.10.13.1.1.1
3.10.28.10.13.1.1.1.1

[top]
Segment boundaries for domain 2vs7A02

Chopping figure for domain 2vs7A02
DomainStart PDB ResidueStop PDB Residue
2vs7A01 4 101
2vs7A02 105 182

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.10.28.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2f4lA03 79.51 Thermotoga maritimaAcetamidase, putative 3.10.28.20 79 5 74 3.08 4.12
2jtvA00 75.96 Rhodopseudomonas palustrisPutative uncharacterized protein 1.10.10.10 65 9 74 3.30 4.44
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2vs7A02
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLNISLRDRIKFVHTILSSHL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2vs7A02
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLNISLRDRIKFVHTILSSHL
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 15 Nov 2008 14:27

Assigning to "3.10.28.10" based on similarity with "1b24A02"

Flow stage update by auto on 15 Nov 2008 14:08

No in_process hits for Domain "2vs7A02" ready to be processed

Flow stage update by auto on 15 Nov 2008 14:08

NW result present for Domain "2vs7A02"

Flow stage update by auto on 15 Nov 2008 08:12

All required files are present for Domain "2vs7A02"

Flow stage update by auto on 14 Nov 2008 11:21

Beginning processing for Domain "2vs7A02"

Insertion by auto on 14 Nov 2008 11:10

Final ChopClose added based on similarity with "1b24A"