CATH Domain: 2vqeE02 XML data for domain: 2vqeE02

Molscript image for 2vqeE02
2vqeE02
PDB coordinates for domain 2vqeE02

PDB 2vqe, Chain E, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.230 Ribosomal Protein S5; domain 2
3.30.230.10 Gene3D
3.30.230.10.19
3.30.230.10.19.1
3.30.230.10.19.1.1
3.30.230.10.19.1.1.1
3.30.230.10.19.1.1.1.1

[top]
Segment boundaries for domain 2vqeE02

Chopping figure for domain 2vqeE02
DomainStart PDB ResidueStop PDB Residue
2vqeE01 5 68
2vqeE02 69 143

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.230.10.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3i1mE02 90.03 RibosomeSmall subunit ribosomal protein S5Translation30S ribosomal protein S5Protein binding 3.30.230.10 86 44 87 1.18 1.35
2ae8B01 80.93 Histidine metabolismMetabolic pathwaysStaphylococcus aureus subsp. aureus N315Imidazoleglycerol-phosphate dehydrataseImidazoleglycerol-phosphate dehydratase [EC:4.2.1.19] 3.30.230.40 77 4 80 3.77 4.68
2ae8A02 79.28 Histidine metabolismMetabolic pathwaysStaphylococcus aureus subsp. aureus N315Imidazoleglycerol-phosphate dehydrataseImidazoleglycerol-phosphate dehydratase [EC:4.2.1.19] 3.30.230.40 90 9 70 3.36 4.80
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2vqeE02
VPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2vqeE02
VPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLR
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 03 May 2008 17:20

Assigning to "3.30.230.10" based on similarity with "1fjfE02"

Flow stage update by auto on 03 May 2008 17:06

No in_process hits for Domain "2vqeE02" ready to be processed

Flow stage update by auto on 03 May 2008 17:06

NW result present for Domain "2vqeE02"

Flow stage update by auto on 03 May 2008 08:28

All required files are present for Domain "2vqeE02"

Flow stage update by auto on 02 May 2008 14:06

Beginning processing for Domain "2vqeE02"

Insertion by auto on 02 May 2008 14:06

Final ChopClose added based on similarity with "1fjfE"