Domain assigned by auto on 29 Mar 2008 17:30
Assigning to "3.40.190.10" based on similarity with "2vozA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2vozB01 | 32 | 129 |
| 2vozB01 | 263 | 309 |
| 2vozB02 | 130 | 262 |
| 2vozB02 | 310 | 346 |
There are 23 matching structural neighberhood comparisons for CATH ID 3.40.190.10.9.2.1.1.1 (SIMAX score < 5)
>pdb|2vozB01 QSRTINLYSSRHYNTDDALYDAFGEVNLIEASAEELIERIQSEGANSPGDILFTVDAGMLWRAEQAGLFQPVRSGKLNER IPENLRHPDGLWYGFTQRVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNEYPVIPGVPI
Assigning to "3.40.190.10" based on similarity with "2vozA01"
No in_process hits for Domain "2vozB01" ready to be processed
Domain "2vozB01" hits Domain "2vozA01" (100% over 98.6206896551724%) which is currently in process
Domain "2vozB01" hits Domain "2vozA01" (100% over 98.6206896551724%) which is currently in process
NW result present for Domain "2vozB01"
All required files are present for Domain "2vozB01"
Beginning processing for Domain "2vozB01"
Final ChopClose added based on similarity with "2vozA"