CATH Domain: 2vooB01 XML data for domain: 2vooB01

Molscript image for 2vooB01
2vooB01
PDB coordinates for domain 2vooB01

PDB 2voo, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.10 "winged helix" repressor DNA binding domain Gene3D
1.10.10.10.10
1.10.10.10.10.1
1.10.10.10.10.1.1
1.10.10.10.10.1.1.1
1.10.10.10.10.1.1.1.1

[top]
Segment boundaries for domain 2vooB01

Chopping figure for domain 2vooB01
DomainStart PDB ResidueStop PDB Residue
2vooB01 9 90
2vooB02 100 185

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 1.10.10.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cuqA02 82.70 ESCRT-II complex subunit VPS22Transcription factor bindingRegulation of transcription from RNA polymerase II promoterHomo sapiensVacuolar-sorting protein SNF8 1.10.10.10 81 12 86 2.93 3.38
1xb4B02 82.40 Protein targeting to vacuoleESCRT-II complex subunit VPS25Saccharomyces cerevisiaeESCRT II complexVacuolar protein-sorting-associated protein 25 1.10.10.10 75 6 79 2.96 3.73
2fokA02 80.72 Planomicrobium okeanokoitesType-2 restriction enzyme FokI 1.10.10.10 82 6 76 3.18 4.14
2heoA00 79.72 Mus musculusLeft-handed Z-DNA bindingZ-DNA-binding protein 1 1.10.10.10 59 10 67 2.87 4.28
1j5yA01 79.64 Thermotoga maritimaTranscriptional regulator, biotin repressor family 1.10.10.10 64 9 69 2.97 4.27
1qbjC00 78.99 CytoplasmNucleolusHomo sapiensDouble-stranded RNA-specific adenosine deaminaseBase conversion or substitution editing 1.10.10.10 66 9 74 3.59 4.83
2dt5B01 78.96 Thermus thermophilus HB8Redox-sensing transcriptional repressor rexAT-rich DNA-binding protein 1.10.10.10 73 6 75 3.54 4.68
1bbyA00 78.66 Basal transcription factorsGeneral transcription factor IIF subunit 2General RNA polymerase II transcription factor activityHomo sapiensTranscription initiation factor TFIIF beta subunit 1.10.10.10 69 8 69 3.26 4.69
2o0yB01 78.21 Rhodococcus jostii RHA1Transcriptional regulator 1.10.10.10 64 6 73 3.60 4.92
1ldjA06 77.47 Cullin-1Cell cycle arrestInduction of apoptosis by intracellular signalsUbiquitin mediated proteolysisWnt signaling pathway 1.10.10.10 68 5 65 2.70 4.10
2jt1A00 77.07 PefI proteinSalmonella enterica subsp. enterica serovar Typhimurium 1.10.10.10 71 11 76 3.83 4.99
1lvaA03 75.69 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 62 4 70 3.29 4.65
1lddA00 75.18 Mitotic sister chromatid segregationProtein ubiquitinationCyclin catabolic processMeiosis - yeastAnaphase-promoting complex subunit 2 1.10.10.10 74 12 76 3.60 4.69
2ipqX01 75.13 Salmonella enterica subsp. enterica serovar TyphiPutative uncharacterized protein 1.10.10.10 44 9 52 2.50 4.77
3cuqD00 74.94 ESCRT-II complex subunit VPS25Homo sapiensVacuolar protein-sorting-associated protein 25Endocytosis 1.10.10.570 97 10 68 3.26 4.79
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2vooB01
KMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTK
IR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2vooB01
GSNGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELME
ISEDKTKIR
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 13 May 2008 14:41

Assigning to "1.10.10.10" based on similarity with "2vodB01"

Flow stage update by auto on 13 May 2008 14:41

No in_process hits for Domain "2vooB01" ready to be processed

Update comment by auto on 13 May 2008 14:38

Domain "2vooB01" hits Domain "2vooA01" (100% over 100%) which is currently in process

Update comment by auto on 13 May 2008 14:35

Domain "2vooB01" hits Domain "2vopA01" (100% over 100%) which is currently in process

Update comment by auto on 13 May 2008 14:32

Domain "2vooB01" hits Domain "2vodB01" (100% over 100%) which is currently in process

Update comment by auto on 13 May 2008 14:27

Domain "2vooB01" hits Domain "2vodA01" (100% over 100%) which is currently in process

Flow stage update by auto on 13 May 2008 14:10

Domain "2vooB01" hits Domain "2vodA01" (100% over 100%) which is currently in process

Flow stage update by auto on 13 May 2008 14:10

NW result present for Domain "2vooB01"

Flow stage update by auto on 13 May 2008 08:16

All required files are present for Domain "2vooB01"

Flow stage update by auto on 12 May 2008 12:29

Beginning processing for Domain "2vooB01"

Insertion by auto on 12 May 2008 11:13

Final ChopClose added based on similarity with "2vodA"