CATH Domain: 2vo4A02 XML data for domain: 2vo4A02

Molscript image for 2vo4A02
2vo4A02
PDB coordinates for domain 2vo4A02

PDB 2vo4, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.20
1.20.1050.10.20.1
1.20.1050.10.20.1.1
1.20.1050.10.20.1.1.1
1.20.1050.10.20.1.1.1.1

[top]
Segment boundaries for domain 2vo4A02

Chopping figure for domain 2vo4A02
DomainStart PDB ResidueStop PDB Residue
2vo4A01 1 87
2vo4A02 88 219

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.20.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gwcA02 87.84 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 33 90 2.14 2.38
1hqoA02 84.85 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 17 77 1.94 2.51
1v2aA02 82.76 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 15 90 2.78 3.08
2dsaA02 82.48 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 18 75 2.00 2.64
1nhyA02 82.11 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 12 87 4.18 4.76
1gnwA02 81.84 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 12 82 2.93 3.55
1aw9A02 81.47 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 11 82 3.09 3.74
2c3nA02 80.24 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 14 77 3.77 4.86
3cbuA02 80.09 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 12 92 3.73 4.04
2gsqA02 75.06 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 12 75 3.28 4.37
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2vo4A02
DPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAY
ETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGIE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2vo4A02
DPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAY
ETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGIE
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 13 Dec 2008 20:36

Assigning to "1.20.1050.10" based on similarity with "1oyjA02"

Flow stage update by auto on 13 Dec 2008 20:15

No in_process hits for Domain "2vo4A02" ready to be processed

Flow stage update by auto on 13 Dec 2008 20:14

NW result present for Domain "2vo4A02"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2vo4A02"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2vo4A02"

Insertion by auto on 08 Dec 2008 11:08

Final ChopClose added based on similarity with "1oyjA"