CATH Domain: 2vk8A03 XML data for domain: 2vk8A03

Molscript image for 2vk8A03
2vk8A03
PDB coordinates for domain 2vk8A03

PDB 2vk8, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.970 Gene3D
3.40.50.970.4
3.40.50.970.4.1
3.40.50.970.4.1.1
3.40.50.970.4.1.1.1
3.40.50.970.4.1.1.1.1

[top]
Segment boundaries for domain 2vk8A03

Chopping figure for domain 2vk8A03
DomainStart PDB ResidueStop PDB Residue
2vk8A01 2 188
2vk8A02 189 352
2vk8A03 353 554

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.50.970.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2wvgA03 90.05 Indolepyruvate decarboxylase [EC:4.1.1.74]Zymomonas mobilisMetabolic pathwaysTryptophan metabolismPyruvate decarboxylase 3.40.50.970 194 31 93 1.93 2.07
1ozhB03 85.11 Acetolactate synthase, catabolicKlebsiella pneumoniae 3.40.50.970 196 12 92 2.69 2.91
1ybhA03 85.00 ChloroplastAcetolactate synthase I/II/III large subunit [EC:2.2.1.6]Acetolactate synthase, chloroplasticValine, leucine and isoleucine biosynthesisMetabolic pathways 3.40.50.970 194 16 89 2.90 3.24
1v5eA03 84.70 3.40.50.970 190 15 91 2.92 3.19
2ihtA03 83.71 Streptomyces clavuligerusCarboxyethylarginine synthase 3.40.50.970 210 14 89 3.11 3.47
1t9bA03 82.79 Acetolactate synthase I/II/III large subunit [EC:2.2.1.6]Metabolic pathwaysValine, leucine and isoleucine biosynthesisButanoate metabolismFlavin adenine dinucleotide binding 3.40.50.970 228 17 82 2.98 3.59
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2vk8A03
TPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTGATLGAAFAAEEI
DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIQKLIHGPKAQYNEIQGWDHLSLLPTFGAKDYETHRV
ATTGEWDKLTQDKSFNDNSKIRMIEVMLPVFDAPQNLVEQAK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2vk8A03
TPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTGATLGAAFAAEEI
DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIQKLIHGPKAQYNEIQGWDHLSLLPTFGAKDYETHRV
ATTGEWDKLTQDKSFNDNSKIRMIEVMLPVFDAPQNLVEQAK
BLAST against CATH

[top]
Domain History Events (18)

Domain assigned by auto on 03 Mar 2009 22:39

Assigning to "3.40.50.970" based on similarity with "2vk8C03"

Flow stage update by auto on 03 Mar 2009 22:39

No in_process hits for Domain "2vk8A03" ready to be processed

Update comment by auto on 03 Mar 2009 22:35

Domain "2vk8A03" hits Domain "2vk4D03" (81.6831683168317% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:31

Domain "2vk8A03" hits Domain "2vk4A03" (81.6831683168317% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:18

Domain "2vk8A03" hits Domain "2vk8C03" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:14

Domain "2vk8A03" hits Domain "2vk1A03" (99.5049504950495% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:10

Domain "2vk8A03" hits Domain "2vk1B03" (99.5049504950495% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:05

Domain "2vk8A03" hits Domain "2vk1C03" (99.5049504950495% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:00

Domain "2vk8A03" hits Domain "2vk1D03" (99.5049504950495% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 21:54

Domain "2vk8A03" hits Domain "2vjyB03" (82.089552238806% over 99.5049504950495%) which is currently in process

Update comment by auto on 03 Mar 2009 21:47

Domain "2vk8A03" hits Domain "2vjyD03" (81.6831683168317% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 21:37

Domain "2vk8A03" hits Domain "2vjyC03" (82.089552238806% over 99.5049504950495%) which is currently in process

Update comment by auto on 03 Mar 2009 21:12

Domain "2vk8A03" hits Domain "2vjyA03" (81.6831683168317% over 100%) which is currently in process

Flow stage update by auto on 03 Mar 2009 20:58

Domain "2vk8A03" hits Domain "2vjyA03" (81.6831683168317% over 100%) which is currently in process

Flow stage update by auto on 03 Mar 2009 20:57

NW result present for Domain "2vk8A03"

Flow stage update by auto on 03 Mar 2009 20:57

All required files are present for Domain "2vk8A03"

Flow stage update by auto on 19 Feb 2009 11:52

Beginning processing for Domain "2vk8A03"

Insertion by auto on 19 Feb 2009 10:26

Final ChopClose added based on similarity with "2vk8D"