CATH Domain: 2vk8A01 XML data for domain: 2vk8A01

Molscript image for 2vk8A01
2vk8A01
PDB coordinates for domain 2vk8A01

PDB 2vk8, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.970 Gene3D
3.40.50.970.7
3.40.50.970.7.1
3.40.50.970.7.1.1
3.40.50.970.7.1.1.1
3.40.50.970.7.1.1.1.1

Segment boundaries for domain 2vk8A01

Chopping figure for domain 2vk8A01
DomainStart PDB ResidueStop PDB Residue
2vk8A01 2 188
2vk8A02 189 352
2vk8A03 353 554

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.40.50.970.7.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2wvgA01 91.99 Indolepyruvate decarboxylase [EC:4.1.1.74]Zymomonas mobilisTryptophan metabolismMetabolic pathwaysPyruvate decarboxylase 3.40.50.970 185 35 98 1.31 1.33
2ez9A01 89.82 Pyruvate oxidase [EC:1.2.3.3]Lactobacillus plantarumPyruvate metabolismPyruvate oxidaseMetabolic pathways 3.40.50.970 184 20 95 1.85 1.93
1ozhD01 89.38 Acetolactate synthase, catabolicKlebsiella pneumoniae 3.40.50.970 176 19 90 1.72 1.89
2uz1A01 89.22 Benzaldehyde lyasePseudomonas fluorescens 3.40.50.970 182 20 95 2.11 2.20
1t9bB01 88.75 Acetolactate synthase I/II/III large subunit [EC:2.2.1.6]Metabolic pathwaysValine, leucine and isoleucine biosynthesisButanoate metabolismFlavin adenine dinucleotide binding 3.40.50.970 185 20 94 2.48 2.63
2ihuA01 87.88 Streptomyces clavuligerusCarboxyethylarginine synthase 3.40.50.970 185 21 94 2.26 2.39
1yd7A00 83.19 Pyrococcus furiosus2-oxoglutarate ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3]Citrate cycle (TCA cycle)2-keto acid:ferredoxin oxidoreductase subunit alphaMetabolic pathways 3.40.50.970 162 12 79 3.03 3.83
2ozlB01 80.73 Pyruvate dehydrogenase (acetyl-transferring) activityPyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1]Citrate cycle (TCA cycle)Pyruvate dehydrogenase E1 component subunit beta, mitochondrialTricarboxylic acid cycle 3.40.50.970 193 9 88 4.06 4.58
2c42A01 78.82 Pyruvate-ferredoxin oxidoreductaseDesulfovibrio africanus 3.40.50.970 257 6 66 2.90 4.33
Displaying entries 1 to 9 (page 1 of 1)


Domain ATOM Sequence

>pdb|2vk8A01
SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSA
LNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR
PVYLGLPANLVDLNVPAKLLQTPIDMS    

Domain COMBS Sequence

>pdb|2vk8A01
MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELS
ALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQ
RPVYLGLPANLVDLNVPAKLLQTPIDMS    

Domain History Events (20)

Domain assigned by auto on 03 Mar 2009 22:45

Assigning to "3.40.50.970" based on similarity with "1qpbA01"

Flow stage update by auto on 03 Mar 2009 22:45

No in_process hits for Domain "2vk8A01" ready to be processed

Update comment by auto on 03 Mar 2009 22:42

Domain "2vk8A01" hits Domain "2vk4B01" (91.4893617021277% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:39

Domain "2vk8A01" hits Domain "2vk8C01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:35

Domain "2vk8A01" hits Domain "2vk4C01" (91.4893617021277% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:31

Domain "2vk8A01" hits Domain "2vk8D01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:18

Domain "2vk8A01" hits Domain "2vk4D01" (91.4893617021277% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:14

Domain "2vk8A01" hits Domain "2vk1A01" (99.468085106383% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:10

Domain "2vk8A01" hits Domain "2vk1B01" (99.468085106383% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:05

Domain "2vk8A01" hits Domain "2vk1D01" (99.468085106383% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:00

Domain "2vk8A01" hits Domain "2vk1C01" (99.468085106383% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 21:54

Domain "2vk8A01" hits Domain "2vjyD01" (91.4893617021277% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 21:47

Domain "2vk8A01" hits Domain "2vjyA01" (91.4893617021277% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 21:37

Domain "2vk8A01" hits Domain "2vjyC01" (91.4893617021277% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 21:12

Domain "2vk8A01" hits Domain "2vjyB01" (91.4893617021277% over 100%) which is currently in process

Flow stage update by auto on 03 Mar 2009 20:58

Domain "2vk8A01" hits Domain "2vjyB01" (91.4893617021277% over 100%) which is currently in process

Flow stage update by auto on 03 Mar 2009 20:57

NW result present for Domain "2vk8A01"

Flow stage update by auto on 03 Mar 2009 20:57

All required files are present for Domain "2vk8A01"

Flow stage update by auto on 19 Feb 2009 11:52

Beginning processing for Domain "2vk8A01"

Insertion by auto on 19 Feb 2009 10:26

Final ChopClose added based on similarity with "2vk8D"