CATH Domain: 2vifA01

2vifA01

PDB 2vif, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.505	SHC Adaptor Protein
3.30.505.10	SHC Adaptor Protein	Gene3D
3.30.505.10.17
3.30.505.10.17.1
3.30.505.10.17.1.1
3.30.505.10.17.1.1.1
3.30.505.10.17.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2vifA01

Domain	Start PDB Residue	Stop PDB Residue
2vifA01	371	496

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.505.10.17.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
2crhA01	84.56	Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis	3.30.505.10	102	26	79	2.52	3.18
1milA00	83.29	Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding	3.30.505.10	104	24	82	2.47	2.99
1ju5A00	81.81	Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway	3.30.505.10	109	26	72	2.28	3.16
2dm0A01	80.82	Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens	3.30.505.10	97	28	70	2.47	3.50
1uurA04	79.78	Protein homodimerization activityNucleusSignal transducer and activator of transcription APositive regulation of transcriptionCytosol	3.30.505.10	132	10	68	3.04	4.46

[top]
Domain ATOM Sequence

>pdb|2vifA01
SLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEG
HTSIVDLIEHSIGDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQ

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2vifA01
SGPMDVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFY
EQPDVEGHTSIVDLIEHSIGDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRS

BLAST against CATH

[top]
Domain History Events (100)

Domain assigned by cuff on 06 Feb 2009 16:01

homology match

Domain assignment manual match h by cuff on 06 Feb 2009 15:59

same superfamily

Homcheck allotment by cuff on 06 Feb 2009 15:55

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Feb 2009 15:55

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Nov 2008 18:06

Domain "2vifA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 06 Nov 2008 18:06

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2vifA01

Flow stage update by auto on 06 Nov 2008 18:02

Retrieved PRC_PFAMCATH results for job ID SID1060666992018608 and results inserted.

Domain scan prc pfamcath by auto on 06 Nov 2008 18:02

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 28 results for 2vifA01

Update comment by auto on 06 Nov 2008 15:02

PRC_PFAMCATH job SID1060666992018608 is not yet finished.

Prc pfamcath submit by auto on 06 Nov 2008 14:59

The entry "2vifA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 14:59

The entry "2vifA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 14:50

Retrieved SSAP results for job ID SID3229465312789440 and results inserted.

Domain scan ssap cath by auto on 06 Nov 2008 14:46

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1800 results for 2vifA01

Update comment by auto on 03 Nov 2008 17:52

SSAP job SID3229465312789440 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:42

The entry "2vifA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:42

The entry "2vifA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:38

Giving up on SSAP job SID3243570204008244 because submission time of Tue Oct 28 12:20:12 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:38:01 2008).

Update comment by auto on 28 Oct 2008 12:41

SSAP job SID3243570204008244 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:20

The entry "2vifA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:20

The entry "2vifA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 09:02

Giving up on SSAP job SID0396100224118016 because submission time of Wed Oct 22 09:33:24 2008 is more than 518400 seconds older than current time (Tue Oct 28 09:02:11 2008).

Update comment by auto on 22 Oct 2008 09:47

SSAP job SID0396100224118016 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:33

The entry "2vifA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:33

The entry "2vifA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:29

Giving up on SSAP job SID4014793488901100 because submission time of Thu Oct 16 06:09:45 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:29:11 2008).

Update comment by auto on 16 Oct 2008 06:27

SSAP job SID4014793488901100 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:09

The entry "2vifA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:09

The entry "2vifA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:46

Giving up on SSAP job SID0183861647536983 because submission time of Fri Oct 10 03:15:21 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:46:04 2008).

Update comment by auto on 10 Oct 2008 03:49

SSAP job SID0183861647536983 is not yet finished.

Flow stage update by auto on 10 Oct 2008 03:15

The entry "2vifA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 03:15

The entry "2vifA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:30

Retrieved PRC results for job ID SID1110903230607904 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 02:30

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 29 results for 2vifA01

Update comment by auto on 09 Oct 2008 06:53

PRC job SID1110903230607904 is not yet finished.

Flow stage update by auto on 09 Oct 2008 06:27

The entry "2vifA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Oct 2008 06:27

The entry "2vifA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 06:11

Retrieved HMM(SAM) results for job ID SID6863387626426208 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 06:11

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 27 results for 2vifA01