CATH Domain: 2vglS00 XML data for domain: 2vglS00

Molscript image for 2vglS00
2vglS00
PDB coordinates for domain 2vglS00

PDB 2vgl, Chain S, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.60 Gene3D
3.30.450.60.2
3.30.450.60.2.1
3.30.450.60.2.1.1
3.30.450.60.2.1.1.1
3.30.450.60.2.1.1.1.1

Segment boundaries for domain 2vglS00

Chopping figure for domain 2vglS00
DomainStart PDB ResidueStop PDB Residue
2vglS00 1 142

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.450.60.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vglM01 85.79 Huntington's diseaseEndocytosisRattus norvegicusClathrin vesicle coatAP-2 complex subunit mu-1 3.30.450.60 141 14 97 3.74 3.82
2j3wA00 78.40 Mus musculusTrafficking protein particle complex subunit 2 3.30.450.70 142 5 85 4.18 4.91
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2vglS00
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAY
LEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE    

Domain COMBS Sequence

>pdb|2vglS00
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAY
LEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE    

Domain History Events (6)

Domain assigned by auto on 29 Dec 2007 23:14

Assigning to "3.30.450.60" based on similarity with "1gw5S00"

Flow stage update by auto on 29 Dec 2007 23:03

No in_process hits for Domain "2vglS00" ready to be processed

Flow stage update by auto on 29 Dec 2007 23:03

NW result present for Domain "2vglS00"

Flow stage update by auto on 29 Dec 2007 08:06

All required files are present for Domain "2vglS00"

Flow stage update by auto on 28 Dec 2007 11:49

Beginning processing for Domain "2vglS00"

Insertion by auto on 28 Dec 2007 11:06

Final ChopClose added based on similarity with "1gw5S"