CATH Domain: 2vcnA01 XML data for domain: 2vcnA01

Molscript image for 2vcnA01
2vcnA01
PDB coordinates for domain 2vcnA01

PDB 2vcn, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.520 Peroxidase; domain 1
1.10.520.10 Gene3D
1.10.520.10.4
1.10.520.10.4.1
1.10.520.10.4.1.1
1.10.520.10.4.1.1.1
1.10.520.10.4.1.1.1.1

[top]
Segment boundaries for domain 2vcnA01

Chopping figure for domain 2vcnA01
DomainStart PDB ResidueStop PDB Residue
2vcnA01 2 131
2vcnA01 239 250
2vcnA02 132 238

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.520.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1itkA01 89.49 Haloarcula marismortuiCatalase-peroxidase 2 1.10.520.10 142 29 92 1.91 2.07
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2vcnA01
GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLL
EPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLHQKLSELGFADA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2vcnA01
MRGSHHHHHHGSGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAHSAGTFDKGTKTGGPFGTIKHPAELAHS
ANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLHQKLSELGFADA
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 08 Dec 2007 18:18

Assigning to "1.10.520.10" based on similarity with "2ggnX01"

Flow stage update by auto on 08 Dec 2007 18:18

No in_process hits for Domain "2vcnA01" ready to be processed

Update comment by auto on 08 Dec 2007 18:15

Domain "2vcnA01" hits Domain "2vcfX01" (99.3506493506493% over 98.0891719745223%) which is currently in process

Update comment by auto on 08 Dec 2007 18:12

Domain "2vcnA01" hits Domain "2v2eA01" (37.6623376623377% over 86.7052023121387%) which is currently in process

Update comment by auto on 08 Dec 2007 14:20

Domain "2vcnA01" hits Domain "2v23A01" (35.0649350649351% over 86.4705882352941%) which is currently in process

Flow stage update by auto on 08 Dec 2007 14:06

Domain "2vcnA01" hits Domain "2v23A01" (35.0649350649351% over 86.4705882352941%) which is currently in process

Flow stage update by auto on 08 Dec 2007 14:06

NW result present for Domain "2vcnA01"

Flow stage update by auto on 08 Dec 2007 06:12

All required files are present for Domain "2vcnA01"

Flow stage update by auto on 07 Dec 2007 10:17

Beginning processing for Domain "2vcnA01"

Insertion by auto on 07 Dec 2007 10:11

Final ChopClose added based on similarity with "2ggnX"