CATH Domain: 2vc4A02 XML data for domain: 2vc4A02

Molscript image for 2vc4A02
2vc4A02
PDB coordinates for domain 2vc4A02

PDB 2vc4, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.470 Ricin (A Subunit), domain 2
4.10.470.10 Ricin (A Subunit), domain 2 Gene3D
4.10.470.10.3
4.10.470.10.3.1
4.10.470.10.3.1.1
4.10.470.10.3.1.1.1
4.10.470.10.3.1.1.1.1

[top]
Segment boundaries for domain 2vc4A02

Chopping figure for domain 2vc4A02
DomainStart PDB ResidueStop PDB Residue
2vc4A01 5 179
2vc4A02 180 267

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 4.10.470.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1m2tA02 92.37 Beta-galactoside-specific lectin 1Viscum album 4.10.470.10 81 32 92 1.12 1.22
1abrA02 91.66 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 4.10.470.10 85 34 95 1.28 1.34
3ktzA02 91.65 Ribosome-inactivating protein geloninGelonium multiflorum 4.10.470.10 83 37 93 4.00 4.29
1hwmA02 90.08 Sambucus ebulusRibosome-inactivating protein 4.10.470.10 86 29 93 1.64 1.76
3hisA02 86.00 Saponaria officinalisSaporin-L3 4.10.470.10 81 28 88 3.51 3.96
1rl0A02 84.85 Dianthus caryophyllusAntiviral protein DAP-30 4.10.470.10 74 22 82 2.27 2.74
1llnA02 81.85 Antiviral protein 2Phytolacca americana 4.10.470.10 81 20 88 2.79 3.15
3brcA01 66.62 Methanothermobacter thermautotrophicus str. Delta HConserved protein 1.10.287.470 34 14 38 1.81 4.68
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2vc4A02
RFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRC
APPPSSQF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2vc4A02
RFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRC
APPPSSQF
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 23 Nov 2007 14:33

Assigning to "4.10.470.10" based on similarity with "1apgA02"

Flow stage update by auto on 23 Nov 2007 14:05

No in_process hits for Domain "2vc4A02" ready to be processed

Flow stage update by auto on 23 Nov 2007 14:03

NW result present for Domain "2vc4A02"

Flow stage update by auto on 23 Nov 2007 14:02

All required files are present for Domain "2vc4A02"

Flow stage update by auto on 13 Nov 2007 22:04

Beginning processing for Domain "2vc4A02"

Insertion by auto on 13 Nov 2007 22:03

Final ChopClose added based on similarity with "1apgA"