CATH Domain: 2vbaC02 XML data for domain: 2vbaC02

Molscript image for 2vbaC02
2vbaC02
PDB coordinates for domain 2vbaC02

PDB 2vba, Chain C, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.47 Peroxisomal Thiolase; Chain A, domain 1
3.40.47.10 Gene3D
3.40.47.10.8
3.40.47.10.8.1
3.40.47.10.8.1.1
3.40.47.10.8.1.1.1
3.40.47.10.8.1.1.1.1

[top]
Segment boundaries for domain 2vbaC02

Chopping figure for domain 2vbaC02
DomainStart PDB ResidueStop PDB Residue
2vbaC01 6 259
2vbaC02 260 406

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.47.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tqyA02 90.50 3-oxoacyl-ACP synthase I [EC:2.3.1.-]Biosynthesis of type II polyketide backboneStreptomyces coelicolorActinorhodin polyketide putative beta-ketoacyl synthase 1 3.40.47.10 160 32 91 1.38 1.51
1tqyB02 90.38 Actinorhodin polyketide putative beta-ketoacyl synthase 2Biosynthesis of type II polyketide backboneStreptomyces coelicolor3-oxoacyl-ACP synthase II [EC:2.3.1.-] 3.40.47.10 148 24 96 2.49 2.58
1hnjA02 78.15 Fatty acid biosynthesisMetabolic pathways3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]3-oxoacyl-[acyl-carrier-protein] synthase 3Escherichia coli K-12 3.40.47.10 146 12 76 3.44 4.51
1tedA02 77.03 Chalcone/stilbene synthase family proteinMycobacterium tuberculosis 3.40.47.10 149 9 77 3.54 4.55
1u6eA02 75.42 3-oxoacyl-[acyl-carrier-protein] synthase 3Beta-ketoacyl ACP synthase [EC:2.3.1.-]Mycobacterium tuberculosis 3.40.47.10 148 10 76 3.65 4.78
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2vbaC02
YGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAG
VQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2vbaC02
YGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAG
VQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 30 Dec 2007 02:29

Assigning to "3.40.47.10" based on similarity with "2vbaD02"

Flow stage update by auto on 30 Dec 2007 02:28

No in_process hits for Domain "2vbaC02" ready to be processed

Update comment by auto on 29 Dec 2007 23:13

Domain "2vbaC02" hits Domain "2vbaD02" (100% over 100%) which is currently in process

Flow stage update by auto on 29 Dec 2007 23:03

Domain "2vbaC02" hits Domain "2vbaD02" (100% over 100%) which is currently in process

Flow stage update by auto on 29 Dec 2007 23:03

NW result present for Domain "2vbaC02"

Flow stage update by auto on 29 Dec 2007 08:06

All required files are present for Domain "2vbaC02"

Flow stage update by auto on 28 Dec 2007 11:49

Beginning processing for Domain "2vbaC02"

Insertion by auto on 28 Dec 2007 11:19

Final ChopClose added based on similarity with "1fj4A"