CATH Domain: 2v9lA00 XML data for domain: 2v9lA00

Molscript image for 2v9lA00
2v9lA00
PDB coordinates for domain 2v9lA00

PDB 2v9l, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.225 L-fuculose-1-phosphate Aldolase
3.40.225.10 L-fuculose-1-phosphate Aldolase Gene3D
3.40.225.10.1
3.40.225.10.1.1
3.40.225.10.1.1.1
3.40.225.10.1.1.1.1
3.40.225.10.1.1.1.1.1

[top]
Segment boundaries for domain 2v9lA00

Chopping figure for domain 2v9lA00
DomainStart PDB ResidueStop PDB Residue
2v9lA00 1 274

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.225.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1pvtA00 84.38 Thermotoga maritimaPentose and glucuronate interconversionsRhamnulose-1-phosphate aldolase [EC:4.1.2.19]Fructose and mannose metabolismSugar-phosphate aldolase 3.40.225.10 224 25 82 2.52 3.07
2opiB00 80.97 Bacteroides thetaiotaomicronL-fuculose-1-phosphate aldolase 3.40.225.10 203 15 73 2.87 3.88
1e4cP00 80.77 Fructose and mannose metabolismL-fuculose-phosphate aldolase [EC:4.1.2.17]L-fuculose phosphate aldolaseL-fucose catabolic processD-arabinose catabolic process 3.40.225.10 206 15 75 2.94 3.92
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2v9lA00
MQNITYSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFR
NVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNGKDRVIMHCHATNLIALTYVLENDTAV
FTRQLWEGSTECLVVFPDGVGILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK
VYSMGGMKQTISREELIALGKRFGVTPLASALAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2v9lA00
MQNITYSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFR
NVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNGKDRVIMHCHATNLIALTYVLENDTAV
FTRQLWEGSTECLVVFPDGVGILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK
VYSMGGMKQTISREELIALGKRFGVTPLASALAL
BLAST against CATH

[top]
Domain History Events (24)

Domain assigned by auto on 20 Jan 2008 06:40

Assigning to "3.40.225.10" based on similarity with "2uyvA00"

Flow stage update by auto on 20 Jan 2008 06:40

No in_process hits for Domain "2v9lA00" ready to be processed

Update comment by auto on 20 Jan 2008 06:37

Domain "2v9lA00" hits Domain "2v9mB00" (98.9051094890511% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:35

Domain "2v9lA00" hits Domain "2v9nB00" (99.2700729927007% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:32

Domain "2v9lA00" hits Domain "2v9nD00" (99.2700729927007% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:30

Domain "2v9lA00" hits Domain "2v9nC00" (99.2700729927007% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:28

Domain "2v9lA00" hits Domain "2v9nA00" (99.2700729927007% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:26

Domain "2v9lA00" hits Domain "2v9mA00" (98.9051094890511% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:23

Domain "2v9lA00" hits Domain "2v9iB00" (99.2673992673993% over 99.6350364963504%) which is currently in process

Update comment by auto on 20 Jan 2008 06:21

Domain "2v9lA00" hits Domain "2v9iA00" (99.2673992673993% over 99.6350364963504%) which is currently in process

Update comment by auto on 20 Jan 2008 06:18

Domain "2v9lA00" hits Domain "2v9eB00" (98.9051094890511% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:16

Domain "2v9lA00" hits Domain "2v9eA00" (98.9051094890511% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:13

Domain "2v9lA00" hits Domain "2v9fA00" (98.9051094890511% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:11

Domain "2v9lA00" hits Domain "2uyuA00" (99.2700729927007% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:08

Domain "2v9lA00" hits Domain "2uyuE00" (99.2700729927007% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 06:00

Domain "2v9lA00" hits Domain "2uyvD00" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 05:42

Domain "2v9lA00" hits Domain "2uyvC00" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2008 05:26

Domain "2v9lA00" hits Domain "2uyvB00" (100% over 100%) which is currently in process

Update comment by auto on 19 Jan 2008 23:15

Domain "2v9lA00" hits Domain "2uyvA00" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Jan 2008 23:04

Domain "2v9lA00" hits Domain "2uyvA00" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Jan 2008 23:04

NW result present for Domain "2v9lA00"

Flow stage update by auto on 19 Jan 2008 11:04

All required files are present for Domain "2v9lA00"

Flow stage update by auto on 18 Jan 2008 11:54

Beginning processing for Domain "2v9lA00"

Insertion by auto on 18 Jan 2008 11:51

Final ChopClose added based on similarity with "2uyvA"