CATH Domain: 2v8hA02 XML data for domain: 2v8hA02

Molscript image for 2v8hA02
2v8hA02
PDB coordinates for domain 2v8hA02

PDB 2v8h, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.360 Gene3D
3.30.70.360.5
3.30.70.360.5.1
3.30.70.360.5.1.1
3.30.70.360.5.1.1.1
3.30.70.360.5.1.1.1.1

[top]
Segment boundaries for domain 2v8hA02

Chopping figure for domain 2v8hA02
DomainStart PDB ResidueStop PDB Residue
2v8hA01 28 247
2v8hA01 364 458
2v8hA02 248 363

Structural Neighbourhood (21 entries)

There are 21 matching structural neighberhood comparisons for CATH ID 3.30.70.360.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 21 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1z2lA02 93.15 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.30.70.360 115 25 97 1.16 1.19
1cg2A02 87.99 Pseudomonas sp. RS-16Carboxypeptidase G2 3.30.70.360 110 19 91 1.99 2.18
1xmbA02 85.24 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.30.70.360 101 7 78 2.05 2.61
3ct9A02 84.15 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.30.70.360 104 15 83 2.61 3.12
2ia0B02 79.59 Pyrococcus furiosusUncharacterized HTH-type transcriptional regulator PF0864 3.30.70.920 99 7 65 2.24 3.42
1q8kA03 79.17 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 subunit 1PolysomeHomo sapiens 3.30.70.1130 116 8 77 2.94 3.79
1usmA00 78.88 Transcriptional coactivatorThermus thermophilus 3.30.1360.20 77 9 57 2.49 4.31
1u0sA00 78.77 Thermotoga maritimaBacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Protein binding 3.30.70.1110 86 5 72 3.55 4.90
1x7vC00 77.79 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.70.900 97 10 79 3.64 4.59
1s99A01 77.54 Bacillus subtilisPutative HMP/thiamine-binding protein ykoF 3.30.70.930 77 10 61 2.42 3.95
2pokA02 77.37 Lysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Peptidase, M20/M25/M40 familyStreptococcus pneumoniae 3.30.70.360 170 12 63 3.14 4.94
1lfwA03 77.31 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.30.70.360 88 6 55 2.24 4.06
1in0A01 77.26 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 5 56 2.35 4.13
2epiB00 77.10 Methanocaldococcus jannaschiiUPF0045 protein MJ1052 3.30.70.930 96 10 63 2.75 4.31
2x3dF01 77.07 Hypothetical proteinSulfolobus solfataricusPutative uncharacterized protein 3.30.70.1340 84 5 65 2.58 3.94
2fb0A00 76.86 Bacteroides thetaiotaomicronPutative uncharacterized protein 3.30.70.900 91 13 75 3.68 4.85
1rwuA00 76.73 Hypothetical proteinUPF0250 protein ybeDEscherichia coli K-12 3.30.70.1460 87 10 64 3.08 4.76
1vr6A01 76.24 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysThermotoga maritima3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]Phospho-2-dehydro-3-deoxyheptonate aldolase 3.30.70.1140 75 10 62 3.00 4.77
2iboA00 76.11 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.930 87 11 61 2.82 4.61
1q5yD00 75.47 CopG family transcriptional regulator, nickel-responsive regulatorNickel-responsive regulatorProtein bindingEscherichia coli K-12 3.30.70.1150 80 7 65 2.86 4.37
1vk8A00 74.67 Thermotoga maritimaPutative uncharacterized protein 3.30.70.930 91 7 65 2.80 4.27
[1]
Displaying entries 1 to 21 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2v8hA02
AYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDD
VLATMLKEAAAEFDRLIKINDGGALSYESETLQVSP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2v8hA02
AYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDD
VLATMLKEAAAEFDRLIKINDGGALSYESETLQVSP
BLAST against CATH

[top]
Domain History Events (16)

Domain assigned by auto on 01 Dec 2007 10:47

Assigning to "3.30.70.360" based on similarity with "2v8hC02"

Flow stage update by auto on 01 Dec 2007 10:46

No in_process hits for Domain "2v8hA02" ready to be processed

Update comment by auto on 01 Dec 2007 10:44

Domain "2v8hA02" hits Domain "2v8hC02" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:42

Domain "2v8hA02" hits Domain "2v8hB02" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:39

Domain "2v8hA02" hits Domain "2v8hD02" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:37

Domain "2v8hA02" hits Domain "2v8gC02" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:34

Domain "2v8hA02" hits Domain "2v8gB02" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:31

Domain "2v8hA02" hits Domain "2v8dA02" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:29

Domain "2v8hA02" hits Domain "2v8gD02" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:22

Domain "2v8hA02" hits Domain "2v8dB02" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:13

Domain "2v8hA02" hits Domain "2v8gA02" (100% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2007 10:04

Domain "2v8hA02" hits Domain "2v8gA02" (100% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2007 10:04

NW result present for Domain "2v8hA02"

Flow stage update by auto on 24 Nov 2007 14:39

All required files are present for Domain "2v8hA02"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2v8hA02"

Insertion by auto on 23 Nov 2007 20:00

Final ChopClose added based on similarity with "2v8gA"