CATH Domain: 2v8hA01 XML data for domain: 2v8hA01

Molscript image for 2v8hA01
2v8hA01
PDB coordinates for domain 2v8hA01

PDB 2v8h, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.14
3.40.630.10.14.1
3.40.630.10.14.1.1
3.40.630.10.14.1.1.1
3.40.630.10.14.1.1.1.1

[top]
Segment boundaries for domain 2v8hA01

Chopping figure for domain 2v8hA01
DomainStart PDB ResidueStop PDB Residue
2v8hA01 28 247
2v8hA01 364 458
2v8hA02 248 363

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.40.630.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1z2lB01 86.82 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.40.630.10 295 27 93 2.60 2.80
3kasA01 79.76 Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis 3.40.630.10 308 10 78 3.78 4.80
2greA01 78.16 Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579 3.40.630.10 233 13 69 2.87 4.11
1cg2A01 78.00 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 14 74 2.75 3.70
1vgyA01 77.36 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.40.630.10 256 8 73 3.07 4.19
2qyvA01 77.11 Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C 3.40.630.10 250 14 71 3.40 4.76
2cf4A01 76.18 Pyrococcus horikoshiiPutative uncharacterized protein PH0519 3.40.630.10 236 13 70 3.25 4.59
3ct9B01 76.16 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.40.630.10 233 14 66 2.89 4.31
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2v8hA01
LSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGK
PTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLM
SVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAVNFHEVCIECVSRSAFAQF
KKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2v8hA01
LSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGK
PTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLM
SVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAVNFHEVCIECVSRSAFAQF
KKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 01 Dec 2007 10:42

Assigning to "3.40.630.10" based on similarity with "2v8hD01"

Flow stage update by auto on 01 Dec 2007 10:42

No in_process hits for Domain "2v8hA01" ready to be processed

Update comment by auto on 01 Dec 2007 10:39

Domain "2v8hA01" hits Domain "2v8hD01" (100% over 100%) which is currently in process

Update comment by auto on 01 Dec 2007 10:37

Domain "2v8hA01" hits Domain "2v8gC01" (99.6825396825397% over 99.6835443037975%) which is currently in process

Update comment by auto on 01 Dec 2007 10:34

Domain "2v8hA01" hits Domain "2v8dA01" (98.7301587301587% over 96.8847352024922%) which is currently in process

Update comment by auto on 01 Dec 2007 10:31

Domain "2v8hA01" hits Domain "2v8dB01" (99.0415335463259% over 98.4126984126984%) which is currently in process

Update comment by auto on 01 Dec 2007 10:29

Domain "2v8hA01" hits Domain "2v8gB01" (99.6825396825397% over 99.6835443037975%) which is currently in process

Update comment by auto on 01 Dec 2007 10:22

Domain "2v8hA01" hits Domain "2v8gD01" (99.6825396825397% over 99.6835443037975%) which is currently in process

Update comment by auto on 01 Dec 2007 10:13

Domain "2v8hA01" hits Domain "2v8gA01" (99.6825396825397% over 99.6835443037975%) which is currently in process

Flow stage update by auto on 01 Dec 2007 10:04

Domain "2v8hA01" hits Domain "2v8gA01" (99.6825396825397% over 99.6835443037975%) which is currently in process

Flow stage update by auto on 01 Dec 2007 10:04

NW result present for Domain "2v8hA01"

Flow stage update by auto on 24 Nov 2007 14:39

All required files are present for Domain "2v8hA01"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2v8hA01"

Insertion by auto on 23 Nov 2007 20:00

Final ChopClose added based on similarity with "2v8gA"