CATH Domain: 2v8fA00 XML data for domain: 2v8fA00

Molscript image for 2v8fA00
2v8fA00
PDB coordinates for domain 2v8fA00

PDB 2v8f, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.30 Dynein light chain 2a, cytoplasmic Gene3D
3.30.450.30.1
3.30.450.30.1.1
3.30.450.30.1.1.1
3.30.450.30.1.1.1.1
3.30.450.30.1.1.1.1.1

[top]
Segment boundaries for domain 2v8fA00

Chopping figure for domain 2v8fA00
DomainStart PDB ResidueStop PDB Residue
2v8fA00 1 139

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.450.30.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3d9yA00 87.76 NucleusCytosolSchizosaccharomyces pombeGuanyl-nucleotide exchange factor activityActin cortical patch 3.30.450.30 126 26 88 1.79 2.02
3nulA00 86.95 SpindlePhragmoplastPlasma membraneCell wallNucleolus 3.30.450.30 126 30 86 1.83 2.10
1vetA00 76.73 Mus musculusKinase activator activityMitogen-activated protein kinase scaffold protein 1Activation of MAPKK activityMAPK signaling pathway 3.30.450.30 122 5 76 3.70 4.82
1stzA02 76.49 Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor 3.30.450.40 149 5 68 3.39 4.95
1ifqB00 75.57 SNARE interactions in vesicular transportMus musculusVesicle-trafficking protein SEC22bGolgi membraneEndoplasmic reticulum membrane 3.30.450.50 125 6 65 2.93 4.49
3citA00 74.34 Pseudomonas syringae pv. tomatoSensor histidine kinase 3.30.450.40 153 4 67 3.25 4.78
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2v8fA00
AGWQSYVDNLMCDGCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDG
DCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2v8fA00
MAGWQSYVDNLMCDGCXQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYV
DGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 22 Dec 2007 20:36

Assigning to "3.30.450.30" based on similarity with "2v8fB00"

Flow stage update by auto on 22 Dec 2007 20:36

No in_process hits for Domain "2v8fA00" ready to be processed

Update comment by auto on 22 Dec 2007 20:23

Domain "2v8fA00" hits Domain "2v8fB00" (99.2857142857143% over 100%) which is currently in process

Update comment by auto on 22 Dec 2007 17:16

Domain "2v8fA00" hits Domain "2v8cA00" (99.2857142857143% over 100%) which is currently in process

Flow stage update by auto on 22 Dec 2007 17:04

Domain "2v8fA00" hits Domain "2v8cA00" (99.2857142857143% over 100%) which is currently in process

Flow stage update by auto on 22 Dec 2007 17:04

NW result present for Domain "2v8fA00"

Flow stage update by auto on 22 Dec 2007 08:05

All required files are present for Domain "2v8fA00"

Flow stage update by auto on 21 Dec 2007 11:39

Beginning processing for Domain "2v8fA00"

Insertion by auto on 21 Dec 2007 11:05

Final ChopClose added based on similarity with "2v8cA"