CATH Domain: 2v6kA02 XML data for domain: 2v6kA02

Molscript image for 2v6kA02
2v6kA02
PDB coordinates for domain 2v6kA02

PDB 2v6k, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.8
1.20.1050.10.8.1
1.20.1050.10.8.1.1
1.20.1050.10.8.1.1.1
1.20.1050.10.8.1.1.1.1

[top]
Segment boundaries for domain 2v6kA02

Chopping figure for domain 2v6kA02
DomainStart PDB ResidueStop PDB Residue
2v6kA01 3 78
2v6kA02 83 212

Structural Neighbourhood (19 entries)

There are 19 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 19 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1oe8A02 84.86 Schistosoma haematobiumGlutathione S-transferase class-mu 28 kDa isozyme 1.20.1050.10 124 13 91 2.98 3.26
1eemA02 84.53 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 13 86 2.45 2.84
3fr3B02 84.43 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum 1.20.1050.10 114 16 85 2.61 3.06
1hqoA02 84.05 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 14 87 3.45 3.93
2gsqA02 83.92 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 17 82 2.89 3.51
1dugA02 83.87 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 17 79 2.42 3.05
3h1nA02 83.43 Bordetella bronchisepticaProbable glutathione S-transferase 1.20.1050.10 115 17 82 3.03 3.68
2dsaA02 83.32 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 16 80 2.99 3.74
2pvqA02 83.18 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 18 77 2.95 3.80
1n2aA02 83.18 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 13 80 2.76 3.45
3cbuA02 83.16 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 14 90 3.95 4.38
1gwcA02 83.16 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 20 86 3.23 3.73
2vo4A02 83.00 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 14 87 3.92 4.50
1gnwA02 82.67 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 16 86 3.49 4.05
3f6dB02 82.58 Anopheles dirusGlutathione transferase GST1-4 1.20.1050.10 123 12 86 3.31 3.81
1aw9A02 82.12 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 18 85 3.72 4.36
1k0oB02 80.93 Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction 1.20.1050.10 123 5 82 3.60 4.37
1m0uA02 80.63 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase S1Metabolism of xenobiotics by cytochrome P450Glutathione peroxidase activity 1.20.1050.10 112 14 79 3.66 4.62
1v2aA02 79.65 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 15 87 3.85 4.38
[1]
Displaying entries 1 to 19 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2v6kA02
PADADGRQRVRALAAIVGCDIHPINNRRILEYLRKTFGADEAAINAWCGTWISAGFDAYEALLAVDPKRGRYSFGDTPTL
ADCYLVPQVESARRFQVDLTPYPLIRAVDAACGELDAFRRAAPAAQPDSA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2v6kA02
PADADGRQRVRALAAIVGCDIHPINNRRILEYLRKTFGADEAAINAWCGTWISAGFDAYEALLAVDPKRGRYSFGDTPTL
ADCYLVPQVESARRFQVDLTPYPLIRAVDAACGELDAFRRAAPAAQPDSA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 27 Jul 2008 20:40

Assigning to "1.20.1050.10" based on similarity with "1fw1A02"

Flow stage update by auto on 27 Jul 2008 20:19

No in_process hits for Domain "2v6kA02" ready to be processed

Flow stage update by auto on 27 Jul 2008 20:18

NW result present for Domain "2v6kA02"

Flow stage update by auto on 26 Jul 2008 11:49

All required files are present for Domain "2v6kA02"

Flow stage update by auto on 25 Jul 2008 19:45

Beginning processing for Domain "2v6kA02"

Insertion by auto on 25 Jul 2008 17:27

Final ChopClose added based on similarity with "1fw1A"