CATH Domain: 2v2gD02 XML data for domain: 2v2gD02

Molscript image for 2v2gD02
2v2gD02
PDB coordinates for domain 2v2gD02

PDB 2v2g, Chain D, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1020 Antioxidant, Horf6; Chain A, domain 2
3.30.1020.10 Antioxidant, Horf6; Chain A, domain2 Gene3D
3.30.1020.10.1
3.30.1020.10.1.1
3.30.1020.10.1.1.1
3.30.1020.10.1.1.1.1
3.30.1020.10.1.1.1.1.1

[top]
Segment boundaries for domain 2v2gD02

Chopping figure for domain 2v2gD02
DomainStart PDB ResidueStop PDB Residue
2v2gD01 2 151
2v2gD02 152 220

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2v2gD02
NFSEILRVIDSLQLTAQKKVATPADWQPGDRCMVVPGVSAEEAKTLFPNMEVKAVPSGKGYLRYTPQPK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2v2gD02
NFSEILRVIDSLQLTAQKKVATPADWQPGDRCMVVPGVSAEEAKTLFPNMEVKAVPSGKGYLRYTPQPKSMGGSRSHHHH
HH
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 12 Apr 2008 14:30

Assigning to "3.30.1020.10" based on similarity with "2v2gA02"

Flow stage update by auto on 12 Apr 2008 14:29

No in_process hits for Domain "2v2gD02" ready to be processed

Update comment by auto on 12 Apr 2008 14:27

Domain "2v2gD02" hits Domain "2v2gB02" (100% over 100%) which is currently in process

Update comment by auto on 12 Apr 2008 14:25

Domain "2v2gD02" hits Domain "2v2gC02" (100% over 100%) which is currently in process

Update comment by auto on 12 Apr 2008 14:19

Domain "2v2gD02" hits Domain "2v2gA02" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Apr 2008 14:06

Domain "2v2gD02" hits Domain "2v2gA02" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Apr 2008 14:06

NW result present for Domain "2v2gD02"

Flow stage update by auto on 12 Apr 2008 08:09

All required files are present for Domain "2v2gD02"

Flow stage update by auto on 11 Apr 2008 11:48

Beginning processing for Domain "2v2gD02"

Insertion by auto on 11 Apr 2008 11:14

Final ChopClose added based on similarity with "2v2gA"