CATH Domain: 2uzyB04 XML data for domain: 2uzyB04

Molscript image for 2uzyB04
2uzyB04
PDB coordinates for domain 2uzyB04

PDB 2uzy, Chain B, Domain 4

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.10 Immunoglobulins Gene3D
2.60.40.10.269
2.60.40.10.269.1
2.60.40.10.269.1.1
2.60.40.10.269.1.1.1
2.60.40.10.269.1.1.1.1

[top]
Segment boundaries for domain 2uzyB04

Chopping figure for domain 2uzyB04
DomainStart PDB ResidueStop PDB Residue
2uzyB01 42 516
2uzyB02 517 561
2uzyB03 562 654
2uzyB04 655 741

Structural Neighbourhood (22 entries)

There are 22 matching structural neighberhood comparisons for CATH ID 2.60.40.10.269.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 22 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1p5uA02 76.74 Yersinia pestisChaperone protein caf1MProtein binding 2.60.40.1070 84 11 77 2.96 3.83
1l0qA02 76.70 Methanosarcina mazeiORF492 2.60.40.670 90 6 76 3.35 4.37
1k85A00 76.59 Bacillus circulansChitinase A1 2.60.40.10 88 11 75 3.28 4.37
1f00I02 76.49 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 2.60.40.1080 89 3 78 3.79 4.82
1ix2A00 76.45 Escherichia coliCopper resistance protein C 2.60.40.1220 97 7 73 3.25 4.44
1f00I01 75.82 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 2.60.40.920 95 6 78 3.14 3.98
1svbA04 75.32 Genome polyproteinTick-borne encephalitis virus (WESTERN SUBTYPE) 2.60.40.350 96 3 65 3.27 4.98
3cmgA04 75.10 Putative beta-galactosidaseBacteroides fragilis NCTC 9343 2.60.40.1560 87 7 85 3.22 3.79
1nctA00 75.07 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 98 6 79 3.77 4.74
1j8kA00 74.23 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 94 5 79 3.51 4.40
1dceA02 74.14 Rattus norvegicusRab geranylgeranyltransferase activityProtein geranylgeranyltransferase type II [EC:2.5.1.60]Geranylgeranyl transferase type-2 subunit alpha 2.60.40.1130 103 10 68 3.35 4.86
1im3D00 74.06 Unique short US2 glycoproteinHuman herpesvirus 5 strain AD169 2.60.40.1200 95 8 77 3.75 4.81
1b4rA00 73.87 Integral to plasma membranePolycystin-1Homophilic cell adhesionHomo sapiensProtein binding 2.60.40.670 80 2 85 4.03 4.74
1cwvA02 73.79 InvasinYersinia pseudotuberculosis 2.60.40.920 97 11 76 3.20 4.19
2fnbA00 73.43 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 95 6 71 3.05 4.26
1cwvA04 73.40 InvasinYersinia pseudotuberculosis 2.60.40.1080 91 11 73 3.57 4.85
2mcmA00 73.34 MacromomycinStreptomyces macromomyceticus 2.60.40.230 112 11 65 3.02 4.63
2qfpA01 73.02 Fe(3+)-Zn(2+) purple acid phosphatasePhaseolus vulgaris 2.60.40.380 97 8 74 3.46 4.66
3bgaA04 72.44 Galactose metabolismBacteroides thetaiotaomicronBeta-galactosidaseSphingolipid metabolismBeta-galactosidase [EC:3.2.1.23] 2.60.40.320 105 8 64 3.08 4.76
1n6uA02 70.60 JAK-STAT cascadeIntegral to plasma membraneType I interferon receptor activityHomo sapiensResponse to virus 2.60.40.10 106 6 70 3.28 4.64
1owwA00 69.89 FibronectinER-Golgi intermediate compartmentPeptide cross-linkingFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 93 5 78 3.66 4.66
1uwyA02 69.06 Carboxypeptidase MPlasma membraneCarboxypeptidase M [EC:3.4.17.12]Homo sapiensMetallocarboxypeptidase activity 2.60.40.1120 97 6 56 2.74 4.83
[1]
Displaying entries 1 to 22 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2uzyB04
VDPVITSISPKYGPMAGGTLLTLTGNHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYRED
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2uzyB04
VDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETS
IFSYREDLHHHHHH
BLAST against CATH

[top]
Domain History Events (45)

Domain assigned by cuff on 06 Jan 2009 13:29

same superfamily

Domain assignment manual match h by cuff on 06 Jan 2009 13:28

homology match

Homcheck allotment by cuff on 06 Jan 2009 13:27

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Jan 2009 13:27

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 21 Oct 2008 04:04

Domain "2uzyB04" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 21 Oct 2008 04:04

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2uzyB04

Flow stage update by auto on 21 Oct 2008 04:02

Retrieved PRC_PFAMCATH results for job ID SID1399830082624976 and results inserted.

Domain scan prc pfamcath by auto on 21 Oct 2008 04:01

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 13 results for 2uzyB04

Update comment by auto on 20 Oct 2008 23:57

PRC_PFAMCATH job SID1399830082624976 is not yet finished.

Flow stage update by auto on 20 Oct 2008 23:56

The entry "2uzyB04" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 20 Oct 2008 23:55

The entry "2uzyB04" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Oct 2008 23:30

Retrieved SSAP results for job ID SID7387202373002577 and results inserted.

Domain scan ssap cath by auto on 20 Oct 2008 23:24

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2404 results for 2uzyB04

Update comment by auto on 16 Oct 2008 03:11

SSAP job SID7387202373002577 is not yet finished.

Flow stage update by auto on 16 Oct 2008 03:09

The entry "2uzyB04" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Oct 2008 03:09

The entry "2uzyB04" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:04

Retrieved PRC results for job ID SID8252591956534968 and inserted them into the database.

Domain scan prc cath by auto on 16 Oct 2008 03:03

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 2uzyB04

Update comment by auto on 15 Oct 2008 23:40

PRC job SID8252591956534968 is not yet finished.

Prc cath submit by auto on 15 Oct 2008 23:37

The entry "2uzyB04" has been submitted to the PRC webservice.

Flow stage update by auto on 15 Oct 2008 23:37

The entry "2uzyB04" has been submitted to the PRC webservice.

Flow stage update by auto on 15 Oct 2008 23:29

Retrieved HMM(SAM) results for job ID SID9062064268960320 and inserted them into the database.

Domain scan sam cath by auto on 15 Oct 2008 23:29

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2uzyB04

Update comment by auto on 15 Oct 2008 08:36

HMM(SAM) job SID9062064268960320 is not yet finished.

Sam cath submit by auto on 15 Oct 2008 08:35

The entry "2uzyB04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 15 Oct 2008 08:35

The entry "2uzyB04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 15 Oct 2008 08:31

Retrieved "2uzyB04" CATHEDRAL results for job ID SID4827581943562144 and inserted them into the database.

Domain scan cathedral cath by auto on 15 Oct 2008 08:31

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 194 results for 2uzyB04

Update comment by auto on 13 Oct 2008 17:57

"2uzyB04" CATHEDRAL job SID4827581943562144 is not yet finished.

Cathedral cath submit by auto on 13 Oct 2008 17:55

The entry "2uzyB04" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 13 Oct 2008 17:55

The entry "2uzyB04" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 13 Oct 2008 17:50

ScanList with 12158 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2uzyB04.scanlist" for "2uzyB04"

Write scan list by auto on 13 Oct 2008 17:50

Writing ScanList containing 12158 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2uzyB04.scanlist" for domain "2uzyB04"

Update comment by auto on 13 Oct 2008 14:39

Waiting for 7 new domains (example : 3emjH00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 10:34

Waiting for 105 new domains (example : 3d5d600) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 06:03

Waiting for 143 new domains (example : 3d5aS00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 03:39

Waiting for 192 new domains (example : 3cksA00) to be processed so that they can be scanned against too.

Update comment by auto on 12 Oct 2008 21:33

Waiting for 233 new domains (example : 3b7kC01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Oct 2008 18:26

Waiting for 276 new domains (example : 2v4iD02) to be processed so that they can be scanned against too.

Flow stage update by auto on 12 Oct 2008 17:40

No satisfactory AssignClose result found.

Flow stage update by auto on 12 Oct 2008 17:17

No in_process hits for Domain "2uzyB04" ready to be processed

Flow stage update by auto on 12 Oct 2008 17:17

NW result present for Domain "2uzyB04"

Flow stage update by auto on 11 Oct 2008 08:41

All required files are present for Domain "2uzyB04"

Flow stage update by auto on 10 Oct 2008 17:39

Beginning processing for Domain "2uzyB04"

Insertion by cuff on 10 Oct 2008 15:18

nice chopping