CATH Domain: 2uzyB03 XML data for domain: 2uzyB03

Molscript image for 2uzyB03
2uzyB03
PDB coordinates for domain 2uzyB03

PDB 2uzy, Chain B, Domain 3

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.10 Immunoglobulins Gene3D
2.60.40.10.268
2.60.40.10.268.1
2.60.40.10.268.1.1
2.60.40.10.268.1.1.1
2.60.40.10.268.1.1.1.1

[top]
Segment boundaries for domain 2uzyB03

Chopping figure for domain 2uzyB03
DomainStart PDB ResidueStop PDB Residue
2uzyB01 42 516
2uzyB02 517 561
2uzyB03 562 654
2uzyB04 655 741

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 2.60.40.10.268.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2uzyB04 85.16 Basal plasma membraneHepatocyte growth factor receptor activityEpithelial cell signaling in Helicobacter pylori infectionPathways in cancerProto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1] 2.60.40.10 79 25 80 1.44 1.79
1ulvA03 79.07 GlucodextranaseArthrobacter globiformis 2.60.40.1560 86 8 81 3.58 4.39
1k85A00 78.22 Bacillus circulansChitinase A1 2.60.40.10 88 10 80 3.51 4.35
3cmgA04 78.07 Putative beta-galactosidaseBacteroides fragilis NCTC 9343 2.60.40.1560 87 6 86 3.84 4.45
1f00I02 77.50 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 2.60.40.1080 89 9 78 3.31 4.21
1p5uA02 76.97 Yersinia pestisChaperone protein caf1MProtein binding 2.60.40.1070 84 4 74 3.24 4.34
1j8kA00 76.93 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 94 5 76 3.15 4.11
1nctA00 76.44 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 98 11 75 3.50 4.64
1b4rA00 76.36 Integral to plasma membranePolycystin-1Homophilic cell adhesionHomo sapiensProtein binding 2.60.40.670 80 6 81 3.39 4.15
2qfpA01 75.93 Fe(3+)-Zn(2+) purple acid phosphatasePhaseolus vulgaris 2.60.40.380 97 8 79 3.87 4.88
2e7hA01 75.78 Cell surfaceOrgan morphogenesisIntegral to plasma membraneEph receptor B4 [EC:2.7.10.1]Homo sapiens 2.60.40.10 89 4 79 3.47 4.35
1f00I01 75.50 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 2.60.40.920 95 6 82 3.35 4.08
2fnbA00 75.47 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 95 5 76 3.67 4.78
1cwvA04 75.21 InvasinYersinia pseudotuberculosis 2.60.40.1080 91 3 78 3.76 4.82
3bgaA04 73.23 Galactose metabolismBacteroides thetaiotaomicronBeta-galactosidaseSphingolipid metabolismBeta-galactosidase [EC:3.2.1.23] 2.60.40.320 105 6 69 3.46 4.98
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2uzyB03
LPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGFNMSIIISNGHGTT
QYSTFSY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2uzyB03
LPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIIS
NGHGTTQYSTFSY
BLAST against CATH

[top]
Domain History Events (45)

Domain assigned by cuff on 06 Jan 2009 13:26

same superfamily

Domain assignment manual match h by cuff on 06 Jan 2009 13:24

homology match

Homcheck allotment by cuff on 06 Jan 2009 13:22

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Jan 2009 13:22

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 21 Oct 2008 09:54

Domain "2uzyB03" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 21 Oct 2008 09:54

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2uzyB03

Flow stage update by auto on 21 Oct 2008 09:52

Retrieved PRC_PFAMCATH results for job ID SID0090790651498944 and results inserted.

Domain scan prc pfamcath by auto on 21 Oct 2008 09:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 13 results for 2uzyB03

Update comment by auto on 21 Oct 2008 04:02

PRC_PFAMCATH job SID0090790651498944 is not yet finished.

Prc pfamcath submit by auto on 21 Oct 2008 03:59

The entry "2uzyB03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 21 Oct 2008 03:59

The entry "2uzyB03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 21 Oct 2008 03:29

Retrieved SSAP results for job ID SID4313036601684368 and results inserted.

Domain scan ssap cath by auto on 21 Oct 2008 03:20

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2544 results for 2uzyB03

Update comment by auto on 16 Oct 2008 03:11

SSAP job SID4313036601684368 is not yet finished.

Flow stage update by auto on 16 Oct 2008 03:10

The entry "2uzyB03" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Oct 2008 03:10

The entry "2uzyB03" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:05

Retrieved PRC results for job ID SID5350346225779486 and inserted them into the database.

Domain scan prc cath by auto on 16 Oct 2008 03:04

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2uzyB03

Update comment by auto on 15 Oct 2008 23:40

PRC job SID5350346225779486 is not yet finished.

Prc cath submit by auto on 15 Oct 2008 23:37

The entry "2uzyB03" has been submitted to the PRC webservice.

Flow stage update by auto on 15 Oct 2008 23:37

The entry "2uzyB03" has been submitted to the PRC webservice.

Flow stage update by auto on 15 Oct 2008 23:30

Retrieved HMM(SAM) results for job ID SID8814333540613088 and inserted them into the database.

Domain scan sam cath by auto on 15 Oct 2008 23:30

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2uzyB03

Update comment by auto on 15 Oct 2008 08:36

HMM(SAM) job SID8814333540613088 is not yet finished.

Sam cath submit by auto on 15 Oct 2008 08:35

The entry "2uzyB03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 15 Oct 2008 08:35

The entry "2uzyB03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 15 Oct 2008 08:31

Retrieved "2uzyB03" CATHEDRAL results for job ID SID0237647626910144 and inserted them into the database.

Domain scan cathedral cath by auto on 15 Oct 2008 08:30

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 194 results for 2uzyB03

Update comment by auto on 13 Oct 2008 17:57

"2uzyB03" CATHEDRAL job SID0237647626910144 is not yet finished.

Cathedral cath submit by auto on 13 Oct 2008 17:55

The entry "2uzyB03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 13 Oct 2008 17:55

The entry "2uzyB03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 13 Oct 2008 17:50

ScanList with 12158 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2uzyB03.scanlist" for "2uzyB03"

Write scan list by auto on 13 Oct 2008 17:50

Writing ScanList containing 12158 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2uzyB03.scanlist" for domain "2uzyB03"

Update comment by auto on 13 Oct 2008 14:39

Waiting for 7 new domains (example : 3emjH00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 10:34

Waiting for 105 new domains (example : 3d5d600) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 06:03

Waiting for 143 new domains (example : 3d5aS00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 03:39

Waiting for 192 new domains (example : 3cksA00) to be processed so that they can be scanned against too.

Update comment by auto on 12 Oct 2008 21:33

Waiting for 233 new domains (example : 3b7kC01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Oct 2008 18:26

Waiting for 276 new domains (example : 2v4iD02) to be processed so that they can be scanned against too.

Flow stage update by auto on 12 Oct 2008 17:40

No satisfactory AssignClose result found.

Flow stage update by auto on 12 Oct 2008 17:17

No in_process hits for Domain "2uzyB03" ready to be processed

Flow stage update by auto on 12 Oct 2008 17:17

NW result present for Domain "2uzyB03"

Flow stage update by auto on 11 Oct 2008 08:41

All required files are present for Domain "2uzyB03"

Flow stage update by auto on 10 Oct 2008 17:39

Beginning processing for Domain "2uzyB03"

Insertion by cuff on 10 Oct 2008 15:18

nice chopping