CATH Domain: 2uzxB02 XML data for domain: 2uzxB02

Molscript image for 2uzxB02
2uzxB02
PDB coordinates for domain 2uzxB02

PDB 2uzx, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.10 Immunoglobulins Gene3D
2.60.40.10.238
2.60.40.10.238.1
2.60.40.10.238.1.1
2.60.40.10.238.1.1.1
2.60.40.10.238.1.1.1.1

[top]
Segment boundaries for domain 2uzxB02

Chopping figure for domain 2uzxB02
DomainStart PDB ResidueStop PDB Residue
2uzxB01 42 531
2uzxB02 532 658

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 2.60.40.10.238.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2uzyB03 89.10 Hepatocyte growth factor receptor activityBasal plasma membranePathways in cancerEpithelial cell signaling in Helicobacter pylori infectionProto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1] 2.60.40.10 87 100 71 0.64 0.89
2uzyB04 79.02 Basal plasma membraneHepatocyte growth factor receptor activityEpithelial cell signaling in Helicobacter pylori infectionPathways in cancerProto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1] 2.60.40.10 79 25 61 1.51 2.44
1l0qA02 74.31 Methanosarcina mazeiORF492 2.60.40.670 90 7 61 2.76 4.51
1ix2A00 73.91 Escherichia coliCopper resistance protein C 2.60.40.1220 97 6 62 2.98 4.74
1ej6A05 73.09 Mammalian orthoreovirus 3 DearingOuter capsid protein lambda-2 2.60.40.10 95 7 61 3.01 4.92
1j8kA00 72.22 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 94 6 67 3.31 4.88
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2uzxB02
APPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCT
LTLSESTMNTLKCTVGPFNMSIIISNGHGTTQYSTFSYVDPV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2uzxB02
APPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCT
LTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPV
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 16 Mar 2009 17:07

Assigning to "2.60.40.10" based on similarity with "2uzxD02"

Flow stage update by auto on 16 Mar 2009 17:04

No in_process hits for Domain "2uzxB02" ready to be processed

Update comment by auto on 06 Jan 2009 15:24

Domain "2uzxB02" hits Domain "2uzxD02" (100% over 100%) which is currently in process

Update comment by auto on 17 Dec 2008 08:17

Domain "2uzxB02" hits Domain "2uzyB03" (100% over 73.2283464566929%) which is currently in process

Flow stage update by auto on 17 Dec 2008 08:16

Domain "2uzxB02" hits Domain "2uzyB03" (100% over 73.2283464566929%) which is currently in process

Flow stage update by auto on 17 Dec 2008 08:16

NW result present for Domain "2uzxB02"

Flow stage update by auto on 10 Dec 2008 14:15

All required files are present for Domain "2uzxB02"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2uzxB02"

Insertion by cuff on 09 Dec 2008 12:26

nice chopping