Domain assigned by auto on 05 Aug 2008 20:34
Assigning to "1.20.140.10" based on similarity with "1ukwA03"
CATH Domain: 2uxwA01
2uxwA01
PDB 2uxw, Chain A, Domain 1
Segment boundaries for domain 2uxwA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2uxwA01 | -2 | 90 |
| 2uxwA01 | 327 | 490 |
| 2uxwA02 | 91 | 211 |
| 2uxwA03 | 212 | 326 |
| 2uxwA04 | 517 | 646 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 1.20.140.10.8.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1ivhA03 | 86.69 | 1.20.140.10 | 141 | 26 | 75 | 1.15 | 1.52 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2uxwA01 QSMSFAVGMFKGQLTTDQVFPYGSGFKVAMHILNNGRFGMAAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLA RMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRDLRIFRIFEGT NDILRLFVALQGCMDKGKELSGLGSA
Domain History Events (6)
Flow stage update by auto on 05 Aug 2008 20:13
No in_process hits for Domain "2uxwA01" ready to be processed
Flow stage update by auto on 05 Aug 2008 20:13
NW result present for Domain "2uxwA01"
Flow stage update by auto on 05 Aug 2008 11:17
All required files are present for Domain "2uxwA01"
Flow stage update by auto on 04 Aug 2008 19:17
Beginning processing for Domain "2uxwA01"
Insertion by cuff on 04 Aug 2008 14:37
fine
