CATH Domain: 2shpA02 XML data for domain: 2shpA02

Molscript image for 2shpA02
2shpA02
PDB coordinates for domain 2shpA02

PDB 2shp, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.11
3.30.505.10.11.1
3.30.505.10.11.1.1
3.30.505.10.11.1.1.1
3.30.505.10.11.1.1.1.1

[top]
Segment boundaries for domain 2shpA02

Chopping figure for domain 2shpA02
DomainStart PDB ResidueStop PDB Residue
2shpA01 2 109
2shpA02 110 215
2shpA03 216 525

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 3.30.505.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ayaA00 91.30 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 45 95 1.45 1.53
2crhA01 88.59 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 26 92 1.93 2.09
1i3zA00 88.05 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 29 90 1.89 2.10
2oq1A01 87.74 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 27 85 1.56 1.83
2dm0A01 87.11 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 25 93 2.69 2.89
1milA00 86.97 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 33 87 2.04 2.33
2iugA00 86.65 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 22 86 2.30 2.66
3bkbA01 85.80 Tyrosine-protein kinase Fes/FpsHomo sapiensCell proliferationMulticellular organismal development 3.30.505.10 93 29 81 2.17 2.67
1ju5A00 85.49 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 36 80 1.81 2.24
2vifA01 84.64 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 26 75 1.92 2.55
2pldA00 84.00 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 27 85 2.04 2.38
2kk6A00 83.20 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 31 79 2.87 3.62
1rpyB00 83.12 SH2B adapter protein 2Nervous system developmentRattus norvegicusInsulin signaling pathwayNeurotrophin signaling pathway 3.30.505.10 85 23 71 3.05 4.28
3cxlA01 81.57 N-chimaerinHomo sapiensSH3/SH2 adaptor activity 3.30.505.10 104 24 79 3.31 4.15
1uurA04 78.34 Protein homodimerization activityNucleusSignal transducer and activator of transcription APositive regulation of transcriptionCytosol 3.30.505.10 132 12 58 2.61 4.47
1bg1A04 76.81 Positive regulation of transcription from RNA polymerase II promoterTemperature homeostasisRegulation of multicellular organism growthNucleusPlasma membrane 3.30.505.10 109 13 76 3.69 4.85
[1]
Displaying entries 1 to 16 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2shpA02
ERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLV
EHYKKNPMVETLGTVLQLKQP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2shpA02
ERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDS
LTDLVEHYKKNPMVETLGTVLQLKQP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:56

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"