Set cath from cathlist by auto on 05 Mar 2006 18:32
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 2 matching structural neighberhood comparisons for CATH ID 2.40.70.10.17.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1fmbA00 | 87.57 | 2.40.70.10 | 104 | 22 | 81 | 1.74 | 2.13 | |
![]() |
1nsoA00 | 75.00 | 2.40.70.10 | 107 | 22 | 81 | 3.70 | 4.53 |
>pdb|2rspA00 LAMTMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWPTDWPVMEAAGIPMRKSRDMIELGVINRDG SLERPLLLFPAVAMVRGSILGRDCLQGLGLRLTNL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"