CATH Domain: 2rl8A00 XML data for domain: 2rl8A00

Molscript image for 2rl8A00
2rl8A00
PDB coordinates for domain 2rl8A00

PDB 2rl8, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.70 Distorted Sandwich
2.70.130 Cation-dependent Mannose-6-phosphate Receptor; Chain A
2.70.130.10 Cation-dependent Mannose-6-phosphate Receptor; Chain A Gene3D
2.70.130.10.1
2.70.130.10.1.1
2.70.130.10.1.1.1
2.70.130.10.1.1.1.1
2.70.130.10.1.1.1.1.1

[top]
Segment boundaries for domain 2rl8A00

Chopping figure for domain 2rl8A00
DomainStart PDB ResidueStop PDB Residue
2rl8A00 4 154

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.70.130.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1q25A03 85.28 Insulin-like growth factor 2 receptorLysosomeBos taurusCation-independent mannose-6-phosphate receptor 2.70.130.10 147 22 90 3.91 4.32
1q25A01 83.14 Insulin-like growth factor 2 receptorLysosomeBos taurusCation-independent mannose-6-phosphate receptor 2.70.130.10 125 12 79 2.34 2.96
1gp0A00 82.32 Cell surfaceInsulin-like growth factor 2 receptorIntegral to plasma membraneReceptor-mediated endocytosisCation-independent mannose-6-phosphate receptor 2.70.130.10 133 16 81 2.76 3.38
1q25A02 81.27 Insulin-like growth factor 2 receptorLysosomeBos taurusCation-independent mannose-6-phosphate receptor 2.70.130.10 156 14 82 3.36 4.09
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rl8A00
KTCDLVGEKGKESEKELALLKRLTPLFQKSFESTVGDMYSYVFRVCREAGQHSSGAGLVQIQKSNGKETVVGRFNETQIF
QGSNWIMLIYKGGDEYDNHCGREQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rl8A00
TEEKTCDLVGEKGKESEKELALLKRLTPLFQKSFESTVGQSPDMYSYVFRVCREAGQHSSGAGLVQIQKSNGKETVVGRF
NETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACS
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 24 Feb 2008 23:28

Assigning to "2.70.130.10" based on similarity with "2rl9A00"

Flow stage update by auto on 24 Feb 2008 23:26

No in_process hits for Domain "2rl8A00" ready to be processed

Update comment by auto on 24 Feb 2008 23:16

Domain "2rl8A00" hits Domain "2rl9B00" (100% over 100%) which is currently in process

Flow stage update by auto on 24 Feb 2008 23:05

Domain "2rl8A00" hits Domain "2rl9B00" (100% over 100%) which is currently in process

Flow stage update by auto on 24 Feb 2008 23:05

NW result present for Domain "2rl8A00"

Flow stage update by auto on 24 Feb 2008 08:43

All required files are present for Domain "2rl8A00"

Flow stage update by auto on 23 Feb 2008 12:17

Beginning processing for Domain "2rl8A00"

Insertion by auto on 23 Feb 2008 10:04

Final ChopClose added based on similarity with "1keoA"