CATH Domain: 2rklB00 XML data for domain: 2rklB00

Molscript image for 2rklB00
2rklB00
PDB coordinates for domain 2rklB00

PDB 2rkl, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.420 Immunoglobulin FC, subunit C Gene3D
1.20.5.420.1
1.20.5.420.1.1
1.20.5.420.1.1.1
1.20.5.420.1.1.1.1
1.20.5.420.1.1.1.1.1

[top]
Segment boundaries for domain 2rklB00

Chopping figure for domain 2rklB00
DomainStart PDB ResidueStop PDB Residue
2rklB00 281 330

Structural Neighbourhood (24 entries)

There are 24 matching structural neighberhood comparisons for CATH ID 1.20.5.420.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 24 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
4hb1A00 91.24 1.20.5.420 44 20 82 0.99 1.21
1jm0A00 90.03 1.20.5.420 48 8 80 0.97 1.21
2fb5A01 85.43 Bacillus cereus ATCC 14579Hypothetical Membrane Spanning Protein 1.10.287.770 72 10 69 1.81 2.61
1t6aA01 82.79 Geobacillus stearothermophilusRbstp2229 protein 1.20.5.850 43 4 58 0.88 1.52
2qjyC01 82.63 Oxidative phosphorylationMetabolic pathwaysRhodobacter sphaeroidesUbiquinol-cytochrome c reductase iron-sulfur subunitUbiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] 1.20.5.510 33 6 64 1.46 2.28
1a2xB00 81.92 Troponin I, fast skeletal muscleTroponin T bindingOryctolagus cuniculus 1.20.5.420 31 3 62 2.40 3.87
1omiA02 79.76 Listeria monocytogenesListeriolysin regulatory protein 1.20.5.460 27 14 54 2.67 4.94
1qexA01 79.67 Enterobacteria phage T4Baseplate structural protein Gp9 1.20.5.960 35 11 70 3.00 4.29
1z0pA00 79.32 Streptococcus pyogenes serotype M1Putative uncharacterized protein 1.20.58.90 73 4 67 3.35 4.99
1lp1B00 78.56 Staphylococcus aureusImmunoglobulin G-binding protein A 1.20.5.420 54 2 64 3.08 4.75
1deeG00 78.45 Staphylococcus aureus subsp. aureus NCTC 8325Immunoglobulin G-binding protein A 1.20.5.420 51 4 60 2.33 3.83
2ohfA03 78.43 CytoplasmATP bindingATP catabolic processHomo sapiensObg-like ATPase 1 1.10.150.300 75 4 65 2.37 3.63
1rh5B00 77.97 Protein transport protein SEC61 subunit gamma and related proteinsProtein exportMethanocaldococcus jannaschiiPreprotein translocase subunit secE 1.20.5.820 56 12 51 1.51 2.92
1go9A00 77.91 1.20.5.480 39 15 66 3.26 4.94
2r44A01 76.64 Cytophaga hutchinsonii ATCC 33406MoxR-like ATPase [EC:3.6.3.-]Putative uncharacterized protein 1.20.5.420 26 11 52 1.17 2.25
1lvfB00 76.05 Rattus norvegicusSyntaxin-6Syntaxin 6SNARE interactions in vesicular transport 1.20.58.90 104 10 43 1.60 3.70
1ozhA03 75.54 Acetolactate synthase, catabolicKlebsiella pneumoniae 1.20.5.740 24 8 48 2.16 4.50
1ez3A00 75.45 Myosin head/neck bindingProtein domain specific bindingActomyosinRattus norvegicusProtein heterodimerization activity 1.20.58.70 124 14 38 1.08 2.79
1lkoA01 72.55 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 1.20.1260.10 145 8 34 1.28 3.71
2cf7A00 71.15 Streptococcus suisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 156 10 32 1.16 3.62
3fvbA00 70.51 BacterioferritinBrucella melitensis biovar Abortus 2308Bacterioferritin 1.20.1260.10 161 8 31 1.18 3.80
2gyqA00 70.46 YcfI, putative structural proteinsRhodopseudomonas palustris 1.20.1260.10 154 10 31 1.35 4.24
2qiwA02 69.11 Corynebacterium glutamicumPEP phosphonomutase and related enzymes 1.20.5.510 18 0 36 1.07 2.97
1o9rA00 68.69 Agrobacterium tumefaciens str. C58DNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 162 18 30 1.38 4.47
[1]
Displaying entries 1 to 24 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rklB00
KDELTKIMDRASKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNSI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rklB00
GSTKDELTKIMDRASKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNSI
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 22 Jan 2009 14:12

Assigning to "1.20.5.420" based on similarity with "2rklD00"

Flow stage update by auto on 22 Jan 2009 13:53

No in_process hits for Domain "2rklB00" ready to be processed

Update comment by auto on 22 Jan 2009 13:32

Domain "2rklB00" hits Domain "2rklF00" (100% over 100%) which is currently in process

Update comment by auto on 22 Jan 2009 13:12

Domain "2rklB00" hits Domain "2rklE00" (100% over 100%) which is currently in process

Update comment by auto on 17 Dec 2008 08:18

Domain "2rklB00" hits Domain "2rklD00" (100% over 100%) which is currently in process

Flow stage update by auto on 17 Dec 2008 08:16

Domain "2rklB00" hits Domain "2rklD00" (100% over 100%) which is currently in process

Flow stage update by auto on 17 Dec 2008 08:16

NW result present for Domain "2rklB00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2rklB00"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2rklB00"

Insertion by auto on 09 Dec 2008 14:07

Final ChopClose added based on similarity with "2rklA"