CATH Domain: 2rk9B00

2rk9B00

PDB 2rk9, Chain B, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.10	Roll
3.10.180	2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1
3.10.180.10	2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	Gene3D
3.10.180.10.22
3.10.180.10.22.1
3.10.180.10.22.1.1
3.10.180.10.22.1.1.1
3.10.180.10.22.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2rk9B00

Domain	Start PDB Residue	Stop PDB Residue
2rk9B00	4	136

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.10.180.10.22.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	3b59A01	82.81	Glyoxalase/bleomycin resistance protein/dioxygenaseNovosphingobium aromaticivorans DSM 12444	3.10.180.10	121	17	90	4.36	4.84
	1tsjA00	80.22	Staphylococcus aureus subsp. aureus MW2Putative uncharacterized protein MW1090	3.10.180.10	111	10	89	3.35	3.74

[top]
Domain ATOM Sequence

>pdb|2rk9B00
TLRVVPELYCFDINVSQSFFVDVLGFEVKYERPDEEFVYLTLDGVDVLEGLEFPLGSGVNFQWDVIDIEPLYQRVNESAA
DSIYLALESKSYQIATQKQFVQTPDGYLFRFCQDI

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2rk9B00
XSLTLRVVPELYCFDINVSQSFFVDVLGFEVKYERPDEEFVYLTLDGVDVXLEGIAGKSRKWLSGDLEFPLGSGVNFQWD
VIDIEPLYQRVNESAADSIYLALESKSYQCGDSIATQKQFXVQTPDGYLFRFCQDIHEGHHHHHH

BLAST against CATH

[top]
Domain History Events (99)

Domain assigned by cuff on 22 Jan 2009 12:41

same superfamily

Domain assignment manual match h by cuff on 22 Jan 2009 12:39

homology match

Homcheck allotment by cuff on 22 Jan 2009 12:37

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 22 Jan 2009 12:37

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Nov 2008 07:09

Domain "2rk9B00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 06 Nov 2008 07:09

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rk9B00

Flow stage update by auto on 06 Nov 2008 06:55

Retrieved PRC_PFAMCATH results for job ID SID4841155578078880 and results inserted.

Domain scan prc pfamcath by auto on 06 Nov 2008 06:55

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 37 results for 2rk9B00

Prc pfamcath submit by auto on 06 Nov 2008 06:42

The entry "2rk9B00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 06:42

The entry "2rk9B00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 06:06

Retrieved SSAP results for job ID SID2510466871982144 and results inserted.

Domain scan ssap cath by auto on 06 Nov 2008 06:05

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1208 results for 2rk9B00

Update comment by auto on 03 Nov 2008 17:51

SSAP job SID2510466871982144 is not yet finished.

Flow stage update by auto on 03 Nov 2008 17:41

The entry "2rk9B00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 03 Nov 2008 17:41

The entry "2rk9B00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:36

Giving up on SSAP job SID2051827754835488 because submission time of Tue Oct 28 12:18:57 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:36:42 2008).

Update comment by auto on 28 Oct 2008 12:36

SSAP job SID2051827754835488 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:18

The entry "2rk9B00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:18

The entry "2rk9B00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 09:01

Giving up on SSAP job SID4626036555165408 because submission time of Wed Oct 22 09:31:58 2008 is more than 518400 seconds older than current time (Tue Oct 28 09:01:06 2008).

Update comment by auto on 22 Oct 2008 09:46

SSAP job SID4626036555165408 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:31

The entry "2rk9B00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:31

The entry "2rk9B00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:28

Giving up on SSAP job SID8276564637824348 because submission time of Thu Oct 16 06:08:49 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:28:02 2008).

Update comment by auto on 16 Oct 2008 06:26

SSAP job SID8276564637824348 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:08

The entry "2rk9B00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:08

The entry "2rk9B00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:44

Giving up on SSAP job SID6768295408325736 because submission time of Fri Oct 10 03:13:38 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:44:05 2008).

Update comment by auto on 10 Oct 2008 03:48

SSAP job SID6768295408325736 is not yet finished.

Flow stage update by auto on 10 Oct 2008 03:13

The entry "2rk9B00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 03:13

The entry "2rk9B00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:22

Retrieved PRC results for job ID SID4985496600154464 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 02:21

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 34 results for 2rk9B00

Update comment by auto on 09 Oct 2008 06:52

PRC job SID4985496600154464 is not yet finished.

Prc cath submit by auto on 09 Oct 2008 06:25

The entry "2rk9B00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 06:25

The entry "2rk9B00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 06:06

Retrieved HMM(SAM) results for job ID SID7694629496768232 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 06:06

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 11 results for 2rk9B00