CATH Domain: 2rivA01 XML data for domain: 2rivA01

Molscript image for 2rivA01
2rivA01
PDB coordinates for domain 2rivA01

PDB 2riv, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.3
3.30.497.10.3.2
3.30.497.10.3.2.1
3.30.497.10.3.2.1.1
3.30.497.10.3.2.1.1.1

[top]
Segment boundaries for domain 2rivA01

Chopping figure for domain 2rivA01
DomainStart PDB ResidueStop PDB Residue
2rivA01 17 190
2rivA01 287 355
2rivA02 191 286

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.30.497.10.3.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3f02B01 90.34 Peripheral nervous system developmentNeuroserpinHomo sapiensCentral nervous system developmentSerine-type endopeptidase inhibitor activity 3.30.497.10 219 26 90 2.07 2.29
1wz9A01 87.46 CytoplasmCellular component movementP53 signaling pathwaySerpin peptidase inhibitor, clade B, member 5Homo sapiens 3.30.497.10 219 25 94 2.41 2.55
1uhgA02 87.01 OvalbuminGallus gallus 3.30.497.10 232 31 92 3.05 3.31
1jmoA01 86.01 Heparin cofactor IIHomo sapiensHeparin cofactor 2Complement and coagulation cascades 3.30.497.10 227 28 92 2.60 2.81
1lj5A01 85.84 Plasminogen activator inhibitor-1Positive regulation of monocyte chemotaxisChagas diseaseCellular response to chemical stimulusNegative regulation of endopeptidase activity 3.30.497.10 225 26 91 3.97 4.36
1k9oI01 85.62 Manduca sextaAlaserpinProtein binding 3.30.497.10 215 22 90 2.35 2.59
1imvA02 84.04 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 22 90 2.75 3.04
2b5tI01 83.99 Antithrombin IIIProtease bindingHomo sapiensAntithrombin-IIIExtracellular space 3.30.497.10 259 30 83 2.42 2.89
1jjoC01 80.79 Mus musculusNeuroserpin 3.30.497.10 149 20 57 1.48 2.59
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rivA01
ATLYKMSSINADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGFQHLI
CSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLIQDLKPNT
IMVLVNYIHFKAQWKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNAAHKAVLHIGEKGTEAAGAMFLEA
IPR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rivA01
SQPNATLYKMSSINADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGF
QHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLIQDL
KPNTIMVLVNYIHFKAQWKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNAAHKAVLHIGEKGTEAAGAM
FLEAIPR
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 18 Oct 2008 14:41

Assigning to "3.30.497.10" based on similarity with "2riwA01"

Flow stage update by auto on 18 Oct 2008 14:40

No in_process hits for Domain "2rivA01" ready to be processed

Update comment by auto on 18 Oct 2008 14:28

Domain "2rivA01" hits Domain "2riwA01" (99.5867768595041% over 97.9757085020243%) which is currently in process

Flow stage update by auto on 18 Oct 2008 14:09

Domain "2rivA01" hits Domain "2riwA01" (99.5867768595041% over 97.9757085020243%) which is currently in process

Flow stage update by auto on 18 Oct 2008 14:09

NW result present for Domain "2rivA01"

Flow stage update by auto on 18 Oct 2008 11:11

All required files are present for Domain "2rivA01"

Flow stage update by auto on 17 Oct 2008 15:08

Beginning processing for Domain "2rivA01"

Insertion by auto on 17 Oct 2008 14:07

Final ChopClose added based on similarity with "2riwA"