CATH Domain: 2rijA03

2rijA03

PDB 2rij, Chain A, Domain 3

CATH Code	Level Description	Links
2	Mainly Beta
2.160	3 Solenoid
2.160.10	UDP N-Acetylglucosamine Acyltransferase; domain 1
2.160.10.10	Hexapeptide repeat proteins	Gene3D
2.160.10.10.5
2.160.10.10.5.1
2.160.10.10.5.1.1
2.160.10.10.5.1.1.1
2.160.10.10.5.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2rijA03

Domain	Start PDB Residue	Stop PDB Residue
2rijA01	0	165
2rijA02	166	206
2rijA03	207	380

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.160.10.10.5.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	3cj8A03	82.68	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC:2.3.1.117]Metabolic pathwaysLysine biosynthesisEnterococcus faecalis	2.160.10.10	134	20	77	3.53	4.53
	3c8vC03	78.87	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	2.160.10.10	156	10	69	3.25	4.65

[top]
Domain ATOM Sequence

>pdb|2rijA03
FLAHIIPEDNTRILESSKVRGASLAAGTTIPGASYVNFNAGTTGACVEGRISSSAIVGEGSDVGGGASILGVLSGTSGNA
ISVGKACLLGANSVTGIPLGDNCIVDAGIAVLEGTKFLLKDAEELAKLNPYFNFDKEIYKGLELKGLNGLHFRQDSISGA
IVALNKKAVK

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2rijA03
FLAHIIPEDNTRILESSKVRXGASLAAGTTIXPGASYVNFNAGTTGACXVEGRISSSAIVGEGSDVGGGASILGVLSGTS
GNAISVGKACLLGANSVTGIPLGDNCIVDAGIAVLEGTKFLLKDAEELAKLNPYFNFDKEIYKGLELKGLNGLHFRQDSI
SGAXIVALNKKAVKLNEALH

BLAST against CATH

[top]
Domain History Events (61)

Domain assigned by cuff on 24 Mar 2009 13:23

homology match

Domain assignment manual match h by cuff on 24 Mar 2009 13:20

same superfamily

Homcheck allotment by cuff on 24 Mar 2009 12:36

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 24 Mar 2009 12:36

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 17:32

Domain "2rijA03" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 17:31

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rijA03

Flow stage update by auto on 19 Mar 2009 14:24

Retrieved PRC_PFAMCATH results for job ID SID6359039851647120 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 14:23

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2rijA03

Update comment by auto on 05 Mar 2009 06:41

PRC_PFAMCATH job SID6359039851647120 is not yet finished.

Flow stage update by auto on 05 Mar 2009 06:36

The entry "2rijA03" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 05 Mar 2009 06:36

The entry "2rijA03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Mar 2009 05:32

Retrieved SSAP results for job ID SID2215615163485602 and results inserted.

Domain scan ssap cath by auto on 05 Mar 2009 05:32

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 23 results for 2rijA03

Update comment by auto on 04 Mar 2009 09:12

SSAP job SID2215615163485602 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 08:52

The entry "2rijA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:52

The entry "2rijA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 06:56

Retrieved PRC results for job ID SID8637592434247591 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 06:55

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 18 results for 2rijA03

Update comment by auto on 04 Mar 2009 01:49

PRC job SID8637592434247591 is not yet finished.

Prc cath submit by auto on 04 Mar 2009 01:43

The entry "2rijA03" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 01:43

The entry "2rijA03" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 00:54

Retrieved HMM(SAM) results for job ID SID7955245092746800 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 00:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2rijA03

Sam cath submit by auto on 03 Mar 2009 23:31

The entry "2rijA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:31

The entry "2rijA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:53

Unable to retrieve "2rijA03" HMM(SAM) results for job "SID6519846905118928"

Update comment by auto on 19 Feb 2009 08:33

HMM(SAM) job SID6519846905118928 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:05

The entry "2rijA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:05

The entry "2rijA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:17

Unable to retrieve "2rijA03" HMM(SAM) results for job "SID4258879635434592"

Update comment by auto on 22 Jan 2009 17:45

HMM(SAM) job SID4258879635434592 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:25

The entry "2rijA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:25

The entry "2rijA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Dec 2008 03:37

Retrieved "2rijA03" CATHEDRAL results for job ID SID6957774648577696 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Dec 2008 03:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 490 results for 2rijA03