CATH Domain: 2rhsD02 XML data for domain: 2rhsD02

Molscript image for 2rhsD02
2rhsD02
PDB coordinates for domain 2rhsD02

PDB 2rhs, Chain D, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.50 OB fold (Dihydrolipoamide Acetyltransferase, E2P)
2.40.50.140 Nucleic acid-binding proteins Gene3D
2.40.50.140.17
2.40.50.140.17.1
2.40.50.140.17.1.1
2.40.50.140.17.1.1.1
2.40.50.140.17.1.1.1.1

[top]
Segment boundaries for domain 2rhsD02

Chopping figure for domain 2rhsD02
DomainStart PDB ResidueStop PDB Residue
2rhsD01 1 38
2rhsD01 161 191
2rhsD02 39 160
2rhsD03 203 404
2rhsD04 408 482
2rhsD05 495 698
2rhsD06 712 799

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 2.40.50.140.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1b7yB02 86.09 Aminoacyl-tRNA biosynthesisPhenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]Phenylalanyl-tRNA synthetase beta chainThermus thermophilus 2.40.50.140 116 29 91 2.90 3.17
1bkbA02 75.60 Pyrobaculum aerophilumTranslation initiation factor 5A 2.40.50.140 62 14 52 2.47 4.68
3d31A02 73.13 Methanosarcina acetivoransPutative sulfate transport system ATP-binding proteinSulfate/molybdate ABC transporter, ATP-binding proteinABC transporters 2.40.50.140 46 17 42 1.83 4.30
1uebA03 72.44 Thermus thermophilus HB8Elongation factor EF-PElongation factor P 2.40.50.140 58 8 44 2.02 4.54
1g29102 71.93 Maltose transport protein MalKThermococcus litoralis 2.40.50.140 45 17 37 1.52 4.00
1oxxK02 71.15 ABC transporter, ATP binding protein (Glucose)Glucose/arabinose transport system ATP-binding proteinSulfolobus solfataricusABC transporters 2.40.50.140 45 15 37 1.71 4.50
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rhsD02
SKDIKNLVVGYIQSKEKLNICQVDIGEEEPVQIVCGAPNVDAGQHVIVAKVGGRLPGGIKIKRAKGERSEGMICSLQEIG
ISSNVVPIFVFPTEVEPGTDALTALYLN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rhsD02
SKDIKNLVVGYIQSKEKHPDADKLNICQVDIGEEEPVQIVCGAPNVDAGQHVIVAKVGGRLPGGIKIKRAKLRGERSEGM
ICSLQEIGISSNVVPKAYENGIFVFPTEVEPGTDALTALYLN
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 22 Jan 2009 12:26

Assigning to "2.40.50.140" based on similarity with "2rhsB02"

Flow stage update by auto on 22 Jan 2009 12:04

No in_process hits for Domain "2rhsD02" ready to be processed

Update comment by auto on 22 Jan 2009 11:43

Domain "2rhsD02" hits Domain "2rhsB02" (100% over 100%) which is currently in process

Update comment by auto on 24 Sep 2008 17:16

Domain "2rhsD02" hits Domain "2rhqB02" (97.4576271186441% over 96.7213114754098%) which is currently in process

Flow stage update by auto on 24 Sep 2008 17:14

Domain "2rhsD02" hits Domain "2rhqB02" (97.4576271186441% over 96.7213114754098%) which is currently in process

Flow stage update by auto on 24 Sep 2008 17:14

NW result present for Domain "2rhsD02"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2rhsD02"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2rhsD02"

Insertion by auto on 22 Sep 2008 14:06

Final ChopClose added based on similarity with "2rhsB"