CATH Domain: 2rhsC00 XML data for domain: 2rhsC00

Molscript image for 2rhsC00
2rhsC00
PDB coordinates for domain 2rhsC00

PDB 2rhs, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.930 BirA Bifunctional Protein; domain 2
3.30.930.10 Bira Bifunctional Protein; Domain 2 Gene3D
3.30.930.10.8
3.30.930.10.8.1
3.30.930.10.8.1.1
3.30.930.10.8.1.1.1
3.30.930.10.8.1.1.1.1

[top]
Segment boundaries for domain 2rhsC00

Chopping figure for domain 2rhsC00
DomainStart PDB ResidueStop PDB Residue
2rhsC00 81 351

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.930.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2iy5A00 83.03 Aminoacyl-tRNA biosynthesisPhenylalanyl-tRNA synthetase alpha chainPhenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]Thermus thermophilus 3.30.930.10 336 43 74 2.18 2.92
1b7yB05 75.37 Aminoacyl-tRNA biosynthesisPhenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]Phenylalanyl-tRNA synthetase beta chainThermus thermophilus 3.30.930.10 191 18 62 2.70 4.30
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rhsC00
ELMEKLNQQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPARDMQDS
FYITDEILMRTHTSPVQARTMEKRNGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKL
FGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMAGFDSNEYSGFAFGMGPDRIA
MLKYGIEDIRYFYTNDVRFLEQFKAVEDRGE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rhsC00
ELMEKLNQQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPARDMQDS
FYITDEILMRTHTSPVQARTMEKRNGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKL
FGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMAGFDSNEYSGFAFGMGPDRIA
MLKYGIEDIRYFYTNDVRFLEQFKAVEDRGE
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 12 Dec 2008 23:48

Assigning to "3.30.930.10" based on similarity with "2rhqA00"

Flow stage update by auto on 12 Dec 2008 23:18

No in_process hits for Domain "2rhsC00" ready to be processed

Update comment by auto on 12 Dec 2008 20:38

Domain "2rhsC00" hits Domain "2rhqA00" (100% over 99.6309963099631%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:36

Domain "2rhsC00" hits Domain "2rhqA00" (100% over 99.6309963099631%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:35

NW result present for Domain "2rhsC00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2rhsC00"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2rhsC00"

Insertion by cuff on 08 Dec 2008 15:29

nice chopping