Domain assigned by cuff on 22 Jan 2009 11:37
homology match
CATH Domain: 2rhqB05
2rhqB05
PDB 2rhq, Chain B, Domain 5
Segment boundaries for domain 2rhqB05
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2rhqB01 | 1 | 38 |
| 2rhqB01 | 161 | 191 |
| 2rhqB02 | 39 | 160 |
| 2rhqB03 | 203 | 404 |
| 2rhqB04 | 408 | 482 |
| 2rhqB05 | 495 | 698 |
| 2rhqB06 | 712 | 799 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.930.10.22.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1b7yB05 | 86.90 | 3.30.930.10 | 191 | 32 | 93 | 2.38 | 2.56 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2rhqB05 ELTDRQHKTRTLKETLEGAGLNQAITYSLVSKDHAKDFALQERPTISLLMPMSEAHATLRQSLLPHLIEATAYNVARKNK DVRLYEIGRVFFGNGEGELPDEVEYLSGILTGEYVVNAWQGKKEEIDFFIAKGVVDRVAEKLNLEFSYKAGKIEGLHPGR TAIVSLEGQDIGFIGELHPQVAADNDLKRTYVFELNYDAMMQVA
Domain History Events (101)
Domain assignment manual match h by cuff on 22 Jan 2009 11:36
superfamily match
Homcheck allotment by cuff on 22 Jan 2009 11:33
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 22 Jan 2009 11:33
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 06 Nov 2008 07:05
Domain "2rhqB05" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 06 Nov 2008 07:05
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rhqB05
Flow stage update by auto on 06 Nov 2008 06:48
Retrieved PRC_PFAMCATH results for job ID SID8218569754324128 and results inserted.
Domain scan prc pfamcath by auto on 06 Nov 2008 06:48
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 29 results for 2rhqB05
Flow stage update by auto on 06 Nov 2008 06:41
The entry "2rhqB05" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 06 Nov 2008 06:41
The entry "2rhqB05" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Nov 2008 05:57
Retrieved SSAP results for job ID SID8242933382222528 and results inserted.
Domain scan ssap cath by auto on 06 Nov 2008 05:56
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 213 results for 2rhqB05
Update comment by auto on 03 Nov 2008 17:50
SSAP job SID8242933382222528 is not yet finished.
Flow stage update by auto on 03 Nov 2008 17:39
The entry "2rhqB05" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 03 Nov 2008 17:39
The entry "2rhqB05" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 14:35
Giving up on SSAP job SID1678300284296264 because submission time of Tue Oct 28 12:16:45 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:35:23 2008).
Update comment by auto on 28 Oct 2008 12:34
SSAP job SID1678300284296264 is not yet finished.
Ssap cath submit by auto on 28 Oct 2008 12:16
The entry "2rhqB05" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 12:16
The entry "2rhqB05" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 08:59
Giving up on SSAP job SID1282218959439616 because submission time of Wed Oct 22 09:30:04 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:59:46 2008).
Update comment by auto on 22 Oct 2008 09:45
SSAP job SID1282218959439616 is not yet finished.
Ssap cath submit by auto on 22 Oct 2008 09:30
The entry "2rhqB05" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 09:30
The entry "2rhqB05" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 06:26
Giving up on SSAP job SID6864853708960048 because submission time of Thu Oct 16 06:07:07 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:26:15 2008).
Update comment by auto on 16 Oct 2008 06:24
SSAP job SID6864853708960048 is not yet finished.
Ssap cath submit by auto on 16 Oct 2008 06:07
The entry "2rhqB05" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 06:07
The entry "2rhqB05" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 03:42
Giving up on SSAP job SID9302114452580848 because submission time of Fri Oct 10 03:10:49 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:42:23 2008).
Update comment by auto on 10 Oct 2008 03:46
SSAP job SID9302114452580848 is not yet finished.
Flow stage update by auto on 10 Oct 2008 03:10
The entry "2rhqB05" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 10 Oct 2008 03:10
The entry "2rhqB05" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 02:07
Retrieved PRC results for job ID SID5028415976474449 and inserted them into the database.
Domain scan prc cath by auto on 10 Oct 2008 02:06
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 2rhqB05
Update comment by auto on 09 Oct 2008 06:50
PRC job SID5028415976474449 is not yet finished.
Prc cath submit by auto on 09 Oct 2008 06:22
The entry "2rhqB05" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Oct 2008 06:22
The entry "2rhqB05" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Oct 2008 05:59
Retrieved HMM(SAM) results for job ID SID5523959440457832 and inserted them into the database.
Domain scan sam cath by auto on 09 Oct 2008 05:58
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2rhqB05
Update comment by auto on 05 Oct 2008 20:55
HMM(SAM) job SID5523959440457832 is not yet finished.
Sam cath submit by auto on 05 Oct 2008 20:37
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Oct 2008 20:37
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Oct 2008 17:56
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID7584388365355552"
Update comment by auto on 03 Oct 2008 03:57
HMM(SAM) job SID7584388365355552 is not yet finished.
Flow stage update by auto on 03 Oct 2008 03:34
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 03 Oct 2008 03:34
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 00:40
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID7746313225123289"
Update comment by auto on 02 Oct 2008 21:08
HMM(SAM) job SID7746313225123289 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 20:45
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 20:45
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 18:28
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID5277324702637072"
Update comment by auto on 02 Oct 2008 15:16
HMM(SAM) job SID5277324702637072 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 14:52
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 14:52
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 12:13
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID6201146429274048"
Update comment by auto on 02 Oct 2008 03:51
HMM(SAM) job SID6201146429274048 is not yet finished.
Flow stage update by auto on 02 Oct 2008 03:19
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 02 Oct 2008 03:19
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 01 Oct 2008 21:06
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID3160352149334880"
Update comment by auto on 27 Sep 2008 12:29
HMM(SAM) job SID3160352149334880 is not yet finished.
Sam cath submit by auto on 27 Sep 2008 12:20
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Sep 2008 12:20
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Sep 2008 09:10
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID5929333991247976"
Update comment by auto on 26 Sep 2008 14:55
HMM(SAM) job SID5929333991247976 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 14:45
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 14:45
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 12:28
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID0178043462533664"
Update comment by auto on 26 Sep 2008 09:18
HMM(SAM) job SID0178043462533664 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 09:07
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 09:07
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 06:40
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID0009761066695072"
Update comment by auto on 26 Sep 2008 03:52
HMM(SAM) job SID0009761066695072 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 03:39
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 03:39
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 00:07
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID1820984783805938"
Update comment by auto on 25 Sep 2008 20:53
HMM(SAM) job SID1820984783805938 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 20:46
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 20:46
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 18:04
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID5303147951239264"
Update comment by auto on 25 Sep 2008 14:59
HMM(SAM) job SID5303147951239264 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 14:52
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 14:52
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 12:37
Unable to retrieve "2rhqB05" HMM(SAM) results for job "SID5842708798806528"
Update comment by auto on 25 Sep 2008 09:49
HMM(SAM) job SID5842708798806528 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 09:41
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 09:41
The entry "2rhqB05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 09:36
Retrieved "2rhqB05" CATHEDRAL results for job ID SID5293842044982102 and inserted them into the database.
Domain scan cathedral cath by auto on 25 Sep 2008 09:36
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 489 results for 2rhqB05
Update comment by auto on 25 Sep 2008 02:05
"2rhqB05" CATHEDRAL job SID5293842044982102 is not yet finished.
Cathedral cath submit by auto on 25 Sep 2008 00:13
The entry "2rhqB05" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 25 Sep 2008 00:13
The entry "2rhqB05" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 24 Sep 2008 23:53
ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rhqB05.scanlist" for "2rhqB05"
Write scan list by auto on 24 Sep 2008 23:52
Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rhqB05.scanlist" for domain "2rhqB05"
Update comment by auto on 24 Sep 2008 21:15
Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 17:32
Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 12:06
Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.
Flow stage update by auto on 24 Sep 2008 11:37
No satisfactory AssignClose result found.
Flow stage update by auto on 24 Sep 2008 11:17
No in_process hits for Domain "2rhqB05" ready to be processed
Flow stage update by auto on 24 Sep 2008 11:17
NW result present for Domain "2rhqB05"
Flow stage update by auto on 23 Sep 2008 08:17
All required files are present for Domain "2rhqB05"
Flow stage update by auto on 22 Sep 2008 15:12
Beginning processing for Domain "2rhqB05"
Insertion by auto on 22 Sep 2008 14:11
Final ChopClose added based on similarity with "2rhsB"
