Domain assigned by cuff on 21 Jan 2009 13:24
homology match
CATH Domain: 2rgrA03
2rgrA03
PDB 2rgr, Chain A, Domain 3
Segment boundaries for domain 2rgrA03
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2rgrA01 | 429 | 561 |
| 2rgrA01 | 609 | 691 |
| 2rgrA02 | 562 | 608 |
| 2rgrA03 | 692 | 860 |
| 2rgrA03 | 974 | 988 |
| 2rgrA04 | 872 | 973 |
| 2rgrA05 | 989 | 1177 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.90.199.10.2.1.1.3.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1ab4A01 | 81.11 | 3.90.199.10 | 271 | 32 | 65 | 1.92 | 2.92 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2rgrA03 IPNVLDGFKPGQRKVLYGCFKKNLKSELKVAQLAPYVSECTAYHHGEQSLAQTIIGLAQNFVGSNNIYLLLPNGAFGTRA TGGKDAAAARYIYTELNKLTRKIFHPADDPLYKYIQEDEKTVEPEWYLPILPMILVNGAEGIGTGWSTYIPPFNPLEIIK NIRHLMNDENMVAFDPHGKIKKYN
Domain History Events (101)
Domain assignment manual match h by cuff on 21 Jan 2009 13:23
same superfamily
Homcheck allotment by cuff on 21 Jan 2009 13:21
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 21 Jan 2009 13:21
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 06 Nov 2008 07:04
Domain "2rgrA03" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 06 Nov 2008 07:03
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rgrA03
Flow stage update by auto on 06 Nov 2008 06:47
Retrieved PRC_PFAMCATH results for job ID SID6414743483528976 and results inserted.
Domain scan prc pfamcath by auto on 06 Nov 2008 06:47
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 11 results for 2rgrA03
Update comment by auto on 06 Nov 2008 00:26
PRC_PFAMCATH job SID6414743483528976 is not yet finished.
Flow stage update by auto on 06 Nov 2008 00:20
The entry "2rgrA03" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 06 Nov 2008 00:20
The entry "2rgrA03" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 05 Nov 2008 23:36
Retrieved SSAP results for job ID SID2219274174066668 and results inserted.
Domain scan ssap cath by auto on 05 Nov 2008 23:35
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 116 results for 2rgrA03
Update comment by auto on 03 Nov 2008 17:50
SSAP job SID2219274174066668 is not yet finished.
Flow stage update by auto on 03 Nov 2008 17:38
The entry "2rgrA03" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 03 Nov 2008 17:38
The entry "2rgrA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 14:34
Giving up on SSAP job SID6660078525881344 because submission time of Tue Oct 28 12:16:02 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:56 2008).
Update comment by auto on 28 Oct 2008 12:33
SSAP job SID6660078525881344 is not yet finished.
Ssap cath submit by auto on 28 Oct 2008 12:16
The entry "2rgrA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 12:16
The entry "2rgrA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 08:59
Giving up on SSAP job SID4954625753355776 because submission time of Wed Oct 22 09:29:06 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:59:20 2008).
Update comment by auto on 22 Oct 2008 09:44
SSAP job SID4954625753355776 is not yet finished.
Ssap cath submit by auto on 22 Oct 2008 09:29
The entry "2rgrA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 09:29
The entry "2rgrA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 06:25
Giving up on SSAP job SID8707661032495256 because submission time of Thu Oct 16 06:06:26 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:25:29 2008).
Update comment by auto on 16 Oct 2008 06:23
SSAP job SID8707661032495256 is not yet finished.
Ssap cath submit by auto on 16 Oct 2008 06:06
The entry "2rgrA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 06:06
The entry "2rgrA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 03:36
Giving up on SSAP job SID0860521133213048 because submission time of Fri Oct 10 03:09:40 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:36:04 2008).
Update comment by auto on 10 Oct 2008 03:45
SSAP job SID0860521133213048 is not yet finished.
Flow stage update by auto on 10 Oct 2008 03:09
The entry "2rgrA03" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 10 Oct 2008 03:09
The entry "2rgrA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 02:02
Retrieved PRC results for job ID SID8697300966021984 and inserted them into the database.
Domain scan prc cath by auto on 10 Oct 2008 02:01
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 5 results for 2rgrA03
Update comment by auto on 08 Oct 2008 18:24
PRC job SID8697300966021984 is not yet finished.
Prc cath submit by auto on 08 Oct 2008 18:12
The entry "2rgrA03" has been submitted to the PRC webservice.
Flow stage update by auto on 08 Oct 2008 18:12
The entry "2rgrA03" has been submitted to the PRC webservice.
Flow stage update by auto on 08 Oct 2008 18:00
Retrieved HMM(SAM) results for job ID SID1156397080002414 and inserted them into the database.
Domain scan sam cath by auto on 08 Oct 2008 18:00
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2rgrA03
Update comment by auto on 03 Oct 2008 21:05
HMM(SAM) job SID1156397080002414 is not yet finished.
Sam cath submit by auto on 03 Oct 2008 20:47
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 20:47
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 18:04
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID0806806499715458"
Update comment by auto on 03 Oct 2008 00:39
HMM(SAM) job SID0806806499715458 is not yet finished.
Sam cath submit by auto on 03 Oct 2008 00:14
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 00:14
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 21:08
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID6627806838020672"
Update comment by auto on 02 Oct 2008 18:27
HMM(SAM) job SID6627806838020672 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 18:10
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 18:10
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 15:15
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID4958496920838872"
Update comment by auto on 02 Oct 2008 12:13
HMM(SAM) job SID4958496920838872 is not yet finished.
Flow stage update by auto on 02 Oct 2008 11:55
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 02 Oct 2008 11:55
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 09:34
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID3651539709287792"
Update comment by auto on 01 Oct 2008 09:03
HMM(SAM) job SID3651539709287792 is not yet finished.
Sam cath submit by auto on 01 Oct 2008 08:56
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 01 Oct 2008 08:56
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 01 Oct 2008 06:18
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID9155748185222976"
Update comment by auto on 26 Sep 2008 17:55
HMM(SAM) job SID9155748185222976 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 17:48
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 17:48
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 14:54
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID5111144652299870"
Update comment by auto on 26 Sep 2008 12:28
HMM(SAM) job SID5111144652299870 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 12:19
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 12:19
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 09:18
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID0679789402754004"
Update comment by auto on 26 Sep 2008 06:40
HMM(SAM) job SID0679789402754004 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 06:31
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 06:31
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 03:52
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID5636408562040256"
Update comment by auto on 26 Sep 2008 00:07
HMM(SAM) job SID5636408562040256 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 23:57
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 23:57
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 20:52
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID9792460896622960"
Update comment by auto on 25 Sep 2008 18:04
HMM(SAM) job SID9792460896622960 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 17:54
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 17:54
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 14:59
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID4059505773945952"
Update comment by auto on 25 Sep 2008 12:37
HMM(SAM) job SID4059505773945952 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 12:25
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 12:25
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 09:48
Unable to retrieve "2rgrA03" HMM(SAM) results for job "SID0681142217091456"
Update comment by auto on 25 Sep 2008 02:54
HMM(SAM) job SID0681142217091456 is not yet finished.
Flow stage update by auto on 25 Sep 2008 02:43
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 25 Sep 2008 02:43
The entry "2rgrA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 02:02
Retrieved "2rgrA03" CATHEDRAL results for job ID SID4272779868564728 and inserted them into the database.
Domain scan cathedral cath by auto on 25 Sep 2008 02:01
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 71 results for 2rgrA03
Cathedral cath submit by auto on 25 Sep 2008 00:12
The entry "2rgrA03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 25 Sep 2008 00:12
The entry "2rgrA03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 24 Sep 2008 23:52
ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rgrA03.scanlist" for "2rgrA03"
Write scan list by auto on 24 Sep 2008 23:51
Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rgrA03.scanlist" for domain "2rgrA03"
Update comment by auto on 24 Sep 2008 21:15
Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 17:32
Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 12:06
Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.
Flow stage update by auto on 24 Sep 2008 11:36
No satisfactory AssignClose result found.
Flow stage update by auto on 24 Sep 2008 11:17
No in_process hits for Domain "2rgrA03" ready to be processed
Flow stage update by auto on 24 Sep 2008 11:17
NW result present for Domain "2rgrA03"
Flow stage update by auto on 23 Sep 2008 08:17
All required files are present for Domain "2rgrA03"
Flow stage update by auto on 22 Sep 2008 15:12
Beginning processing for Domain "2rgrA03"
Insertion by cuff on 22 Sep 2008 13:19
nice chopping
