CATH Domain: 2rgqB00

2rgqB00

PDB 2rgq, Chain B, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.10	Roll
3.10.450	Nuclear Transport Factor 2; Chain: A,
3.10.450.50		Gene3D
3.10.450.50.16
3.10.450.50.16.1
3.10.450.50.16.1.1
3.10.450.50.16.1.1.1
3.10.450.50.16.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2rgqB00

Domain	Start PDB Residue	Stop PDB Residue
2rgqB00	2	134

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.10.450.50.16.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3b7cA00	84.10	Shewanella oneidensisPutative uncharacterized protein	3.10.450.50	115	13	87	2.93	3.33
3cnxA00	84.09	Streptomyces avermitilisPutative uncharacterized protein	3.10.450.50	135	9	86	3.00	3.46
3blzA00	83.15	Shewanella baltica OS155Putative uncharacterized protein	3.10.450.50	123	15	87	2.60	2.99
3bb9B00	83.15	Putative orphan proteinShewanella frigidimarina NCIMB 400	3.10.450.50	120	11	89	3.92	4.38
1tuhA00	82.05	Uncultured bacteriumPutative uncharacterized protein	3.10.450.50	131	8	86	3.37	3.91
2ux0B00	81.55	Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex	3.10.450.50	136	11	83	3.40	4.06
3cu3A00	81.34	Domain of unknown function with a cystatin-like foldNostoc punctiforme PCC 73102	3.10.450.50	160	16	76	3.59	4.71
2owpA00	80.78	Burkholderia xenovorans LB400Putative uncharacterized protein	3.10.450.50	124	10	89	3.09	3.45
1vqqB01	79.40	Staphylococcus aureusPenicillin binding protein 2'	3.10.450.100	103	13	79	3.42	4.33
1of5B00	76.91	Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae	3.10.450.50	128	3	82	3.45	4.17

[top]
Domain ATOM Sequence

>pdb|2rgqB00
ELTALDKLEIELAARFESLDKEDVENYLATFASDGALQGFWGIAKGKEELRQGFYALDTFARGKRHCSSNAIIQGNYDEA
TESYLTVVNREDLNRAGSAFVKDQVRKINGKWYLILRQIEVDPSLPLLQ

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2rgqB00
GXELTALDKLEIXELAARFEXSLDKEDVENYLATFASDGALQGFWGIAKGKEELRQGFYAXLDTFARGKRHCSSNAIIQG
NYDEATXESYLTVVNREDLNRAGSAFVKDQVRKINGKWYLILRQIEVDPSLPLLQQSQQAGANA

BLAST against CATH

[top]
Domain History Events (101)

Domain assigned by cuff on 21 Jan 2009 13:12

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 13:10

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 13:08

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 13:08

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 20:57

Domain "2rgqB00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 20:57

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rgqB00

Flow stage update by auto on 05 Nov 2008 20:53

Retrieved PRC_PFAMCATH results for job ID SID6582235207680196 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 20:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2rgqB00

Update comment by auto on 05 Nov 2008 17:55

PRC_PFAMCATH job SID6582235207680196 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 17:51

The entry "2rgqB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 17:51

The entry "2rgqB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 17:36

Retrieved SSAP results for job ID SID3386289615921824 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 17:32

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1191 results for 2rgqB00

Update comment by auto on 03 Nov 2008 17:50

SSAP job SID3386289615921824 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:39

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:39

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:35

Giving up on SSAP job SID4652265590280012 because submission time of Tue Oct 28 12:16:23 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:35:11 2008).

Update comment by auto on 28 Oct 2008 12:34

SSAP job SID4652265590280012 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:16

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:16

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:59

Giving up on SSAP job SID9910377377405440 because submission time of Wed Oct 22 09:29:28 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:59:33 2008).

Update comment by auto on 22 Oct 2008 09:45

SSAP job SID9910377377405440 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:29

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:29

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:25

Giving up on SSAP job SID4498088157865672 because submission time of Thu Oct 16 06:06:43 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:25:51 2008).

Update comment by auto on 16 Oct 2008 06:24

SSAP job SID4498088157865672 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:06

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:06

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:36

Giving up on SSAP job SID5210720501347972 because submission time of Fri Oct 10 03:10:10 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:36:22 2008).

Update comment by auto on 10 Oct 2008 03:46

SSAP job SID5210720501347972 is not yet finished.

Flow stage update by auto on 10 Oct 2008 03:10

The entry "2rgqB00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 03:10

The entry "2rgqB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:04

Retrieved PRC results for job ID SID0155949304953584 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 02:03

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2rgqB00

Update comment by auto on 09 Oct 2008 06:50

PRC job SID0155949304953584 is not yet finished.

Prc cath submit by auto on 09 Oct 2008 06:21

The entry "2rgqB00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 06:21

The entry "2rgqB00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 05:57

Retrieved HMM(SAM) results for job ID SID5980370011293327 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 05:56

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2rgqB00