Domain assigned by cuff on 21 Jan 2009 13:01
homology match
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.10
| Roll | |
3.10.450
| Nuclear Transport Factor 2; Chain: A, | |
3.10.450.50
| Gene3D | |
3.10.450.50.5
| ||
3.10.450.50.5.1
| ||
3.10.450.50.5.1.1
| ||
3.10.450.50.5.1.1.1
| ||
3.10.450.50.5.1.1.1.1
|
There are 12 matching structural neighberhood comparisons for CATH ID 3.10.450.50.5.1.1.1.1 (SIMAX score < 5)
>pdb|2rfrA00 GDDLTNLAARLRLLEDREEIRELIARYGPLADSGDAEALSELWVEDGEYAVVGFATAKGRAAIAALIDGQTHRALADGCA HFLGPATVTVEGDTATARCHSVVFRCVSGTFGSHRVSANRWTFRRTPAGWRAVRRENALLDGSAAARALLQF
homology match
same superfamily
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2rfrA00" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rfrA00
Retrieved PRC_PFAMCATH results for job ID SID0238626049777544 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 61 results for 2rfrA00
PRC_PFAMCATH job SID0238626049777544 is not yet finished.
The entry "2rfrA00" has been submitted to the PRC_PFAMCATH webservice.
The entry "2rfrA00" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID2003204098881920 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1230 results for 2rfrA00
SSAP job SID2003204098881920 is not yet finished.
The entry "2rfrA00" has been submitted to the SSAP webservice.
The entry "2rfrA00" has been submitted to the SSAP webservice.
Giving up on SSAP job SID1082763520499136 because submission time of Tue Oct 28 12:15:34 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:35 2008).
SSAP job SID1082763520499136 is not yet finished.
The entry "2rfrA00" has been submitted to the SSAP webservice.
The entry "2rfrA00" has been submitted to the SSAP webservice.
Giving up on SSAP job SID0219252381159232 because submission time of Wed Oct 22 09:28:40 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:59:03 2008).
SSAP job SID0219252381159232 is not yet finished.
The entry "2rfrA00" has been submitted to the SSAP webservice.
The entry "2rfrA00" has been submitted to the SSAP webservice.
Giving up on SSAP job SID9279272995011024 because submission time of Thu Oct 16 06:06:04 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:22:33 2008).
SSAP job SID9279272995011024 is not yet finished.
The entry "2rfrA00" has been submitted to the SSAP webservice.
The entry "2rfrA00" has been submitted to the SSAP webservice.
Giving up on SSAP job SID4668447909857470 because submission time of Fri Oct 10 03:08:57 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:35:34 2008).
SSAP job SID4668447909857470 is not yet finished.
The entry "2rfrA00" has been submitted to the SSAP webservice.
The entry "2rfrA00" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID6776328820428128 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 18 results for 2rfrA00
PRC job SID6776328820428128 is not yet finished.
The entry "2rfrA00" has been submitted to the PRC webservice.
The entry "2rfrA00" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID3761801643755488 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 8 results for 2rfrA00
HMM(SAM) job SID3761801643755488 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID0071551038010304"
HMM(SAM) job SID0071551038010304 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID6411417929166749"
HMM(SAM) job SID6411417929166749 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID1750259540997672"
HMM(SAM) job SID1750259540997672 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID3249569230741920"
HMM(SAM) job SID3249569230741920 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID7734276675488472"
HMM(SAM) job SID7734276675488472 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID4467844512850722"
HMM(SAM) job SID4467844512850722 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID0703607054598160"
HMM(SAM) job SID0703607054598160 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID6741201969653808"
HMM(SAM) job SID6741201969653808 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID2298208189446624"
HMM(SAM) job SID2298208189446624 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID2360467044684208"
HMM(SAM) job SID2360467044684208 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID5956815487871072"
HMM(SAM) job SID5956815487871072 is not yet finished.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.
Retrieved "2rfrA00" CATHEDRAL results for job ID SID1990568324513632 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 50 results for 2rfrA00
The entry "2rfrA00" has been submitted to the CATHEDRAL webservice.
The entry "2rfrA00" has been submitted to the CATHEDRAL webservice.
ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rfrA00.scanlist" for "2rfrA00"
Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rfrA00.scanlist" for domain "2rfrA00"
Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.
Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.
Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2rfrA00" ready to be processed
NW result present for Domain "2rfrA00"
All required files are present for Domain "2rfrA00"
Beginning processing for Domain "2rfrA00"
nice chopping