CATH Domain: 2rfrA00 XML data for domain: 2rfrA00

Molscript image for 2rfrA00
2rfrA00
PDB coordinates for domain 2rfrA00

PDB 2rfr, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.5
3.10.450.50.5.1
3.10.450.50.5.1.1
3.10.450.50.5.1.1.1
3.10.450.50.5.1.1.1.1

Segment boundaries for domain 2rfrA00

Chopping figure for domain 2rfrA00
DomainStart PDB ResidueStop PDB Residue
2rfrA00 0 153

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.10.450.50.5.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cnxA00 85.03 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 21 81 2.43 2.98
2rgqB00 84.92 3.10.450.50 124 20 81 3.64 4.46
2ux0B00 83.07 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 13 86 2.81 3.24
1jkgA00 82.40 CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1 3.10.450.50 139 9 84 3.29 3.91
3b7cA00 81.65 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 10 75 2.34 3.09
1gy6A00 81.65 Nuclear transport factor 2Nuclear poreHomo sapiensProtein bindingCytosol 3.10.450.50 125 10 81 3.52 4.31
1tp6A00 81.53 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.450.50 126 10 76 2.20 2.88
1idpA00 81.32 Scytalone dehydrataseMagnaporthe grisea 3.10.450.50 147 11 84 3.82 4.50
3blzA00 81.08 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 11 78 2.94 3.76
2owpA00 80.89 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 17 78 3.07 3.92
2r4iA00 79.62 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 11 74 3.65 4.91
1of5B00 79.14 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 7 78 3.53 4.47
Displaying entries 1 to 12 (page 1 of 1)


Domain ATOM Sequence

>pdb|2rfrA00
GDDLTNLAARLRLLEDREEIRELIARYGPLADSGDAEALSELWVEDGEYAVVGFATAKGRAAIAALIDGQTHRALADGCA
HFLGPATVTVEGDTATARCHSVVFRCVSGTFGSHRVSANRWTFRRTPAGWRAVRRENALLDGSAAARALLQF    

Domain COMBS Sequence

>pdb|2rfrA00
GXDDLTNLAARLRLLEDREEIRELIARYGPLADSGDAEALSELWVEDGEYAVVGFATAKGRAAIAALIDGQTHRALXADG
CAHFLGPATVTVEGDTATARCHSVVFRCVSGTFGSHRVSANRWTFRRTPAGWRAVRRENALLDGSAAARALLQFR    

Domain History Events (101)

Domain assigned by cuff on 21 Jan 2009 13:01

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 13:00

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 12:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 12:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Nov 2008 00:35

Domain "2rfrA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 06 Nov 2008 00:34

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rfrA00

Flow stage update by auto on 06 Nov 2008 00:25

Retrieved PRC_PFAMCATH results for job ID SID0238626049777544 and results inserted.

Domain scan prc pfamcath by auto on 06 Nov 2008 00:24

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 61 results for 2rfrA00

Update comment by auto on 05 Nov 2008 20:52

PRC_PFAMCATH job SID0238626049777544 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 20:49

The entry "2rfrA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 20:49

The entry "2rfrA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 20:28

Retrieved SSAP results for job ID SID2003204098881920 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 20:26

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1230 results for 2rfrA00

Update comment by auto on 03 Nov 2008 17:49

SSAP job SID2003204098881920 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:38

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:38

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:34

Giving up on SSAP job SID1082763520499136 because submission time of Tue Oct 28 12:15:34 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:35 2008).

Update comment by auto on 28 Oct 2008 12:33

SSAP job SID1082763520499136 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:15

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:15

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:59

Giving up on SSAP job SID0219252381159232 because submission time of Wed Oct 22 09:28:40 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:59:03 2008).

Update comment by auto on 22 Oct 2008 09:44

SSAP job SID0219252381159232 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:28

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:28

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:22

Giving up on SSAP job SID9279272995011024 because submission time of Thu Oct 16 06:06:04 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:22:33 2008).

Update comment by auto on 16 Oct 2008 06:23

SSAP job SID9279272995011024 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:06

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:06

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:35

Giving up on SSAP job SID4668447909857470 because submission time of Fri Oct 10 03:08:57 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:35:34 2008).

Update comment by auto on 10 Oct 2008 03:45

SSAP job SID4668447909857470 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:08

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:08

The entry "2rfrA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:59

Retrieved PRC results for job ID SID6776328820428128 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:58

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 18 results for 2rfrA00

Update comment by auto on 09 Oct 2008 04:01

PRC job SID6776328820428128 is not yet finished.

Flow stage update by auto on 09 Oct 2008 03:38

The entry "2rfrA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Oct 2008 03:38

The entry "2rfrA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 03:31

Retrieved HMM(SAM) results for job ID SID3761801643755488 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 03:30

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 8 results for 2rfrA00

Update comment by auto on 05 Oct 2008 17:55

HMM(SAM) job SID3761801643755488 is not yet finished.

Flow stage update by auto on 05 Oct 2008 17:39

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 05 Oct 2008 17:39

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Oct 2008 15:00

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID0071551038010304"

Update comment by auto on 03 Oct 2008 03:56

HMM(SAM) job SID0071551038010304 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 03:32

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 03:32

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:39

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID6411417929166749"

Update comment by auto on 02 Oct 2008 21:07

HMM(SAM) job SID6411417929166749 is not yet finished.

Flow stage update by auto on 02 Oct 2008 20:44

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 20:44

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:27

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID1750259540997672"

Update comment by auto on 02 Oct 2008 15:15

HMM(SAM) job SID1750259540997672 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 14:51

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:51

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:12

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID3249569230741920"

Update comment by auto on 02 Oct 2008 03:50

HMM(SAM) job SID3249569230741920 is not yet finished.

Flow stage update by auto on 02 Oct 2008 03:18

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 03:18

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 01 Oct 2008 21:06

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID7734276675488472"

Update comment by auto on 27 Sep 2008 12:28

HMM(SAM) job SID7734276675488472 is not yet finished.

Flow stage update by auto on 27 Sep 2008 12:19

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 27 Sep 2008 12:19

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Sep 2008 09:10

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID4467844512850722"

Update comment by auto on 26 Sep 2008 14:54

HMM(SAM) job SID4467844512850722 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 14:44

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 14:44

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 12:27

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID0703607054598160"

Update comment by auto on 26 Sep 2008 09:17

HMM(SAM) job SID0703607054598160 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 09:06

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 09:06

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 06:39

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID6741201969653808"

Update comment by auto on 26 Sep 2008 03:51

HMM(SAM) job SID6741201969653808 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 03:38

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 03:38

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 00:06

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID2298208189446624"

Update comment by auto on 25 Sep 2008 18:03

HMM(SAM) job SID2298208189446624 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 17:54

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 17:54

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 14:59

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID2360467044684208"

Update comment by auto on 25 Sep 2008 12:36

HMM(SAM) job SID2360467044684208 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 12:25

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 12:25

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 09:48

Unable to retrieve "2rfrA00" HMM(SAM) results for job "SID5956815487871072"

Update comment by auto on 25 Sep 2008 02:53

HMM(SAM) job SID5956815487871072 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 02:43

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 02:43

The entry "2rfrA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 02:00

Retrieved "2rfrA00" CATHEDRAL results for job ID SID1990568324513632 and inserted them into the database.

Domain scan cathedral cath by auto on 25 Sep 2008 01:59

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 50 results for 2rfrA00

Cathedral cath submit by auto on 25 Sep 2008 00:11

The entry "2rfrA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 25 Sep 2008 00:11

The entry "2rfrA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 Sep 2008 23:51

ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rfrA00.scanlist" for "2rfrA00"

Write scan list by auto on 24 Sep 2008 23:50

Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rfrA00.scanlist" for domain "2rfrA00"

Update comment by auto on 24 Sep 2008 21:15

Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 17:32

Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 12:06

Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.

Flow stage update by auto on 24 Sep 2008 11:36

No satisfactory AssignClose result found.

Flow stage update by auto on 24 Sep 2008 11:17

No in_process hits for Domain "2rfrA00" ready to be processed

Flow stage update by auto on 24 Sep 2008 11:17

NW result present for Domain "2rfrA00"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2rfrA00"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2rfrA00"

Insertion by cuff on 22 Sep 2008 13:19

nice chopping