CATH Domain: 2rfqC03 XML data for domain: 2rfqC03

Molscript image for 2rfqC03
2rfqC03
PDB coordinates for domain 2rfqC03

PDB 2rfq, Chain C, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.140 Butyryl-CoA Dehydrogenase, subunit A; domain 3
1.20.140.10 Butyryl-CoA Dehydrogenase, subunit A, domain 3 Gene3D
1.20.140.10.4
1.20.140.10.4.1
1.20.140.10.4.1.1
1.20.140.10.4.1.1.1
1.20.140.10.4.1.1.1.1

[top]
Segment boundaries for domain 2rfqC03

Chopping figure for domain 2rfqC03
DomainStart PDB ResidueStop PDB Residue
2rfqC01 4 111
2rfqC02 112 206
2rfqC03 207 391

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.20.140.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2or0A03 89.29 Rhodococcus jostii RHA1Hydroxylase 1.20.140.10 179 30 93 1.88 2.00
1siqA03 84.50 Fatty acid metabolismGlutaryl-CoA dehydrogenase [EC:1.3.99.7]Glutaryl-CoA dehydrogenase activityHomo sapiensGlutaryl-CoA dehydrogenase, mitochondrial 1.20.140.10 155 7 85 3.25 3.81
1r2jA03 82.77 Streptomyces hygroscopicus subsp. ascomyceticusFkbI 1.20.140.10 144 17 79 3.22 4.06
1ivhA03 82.45 Isovaleryl-CoA dehydrogenase, mitochondrialHomo sapiens 1.20.140.10 141 12 78 2.15 2.75
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rfqC03
FKASNLTAPGLERNTAPVYKPWGTIHPTTISAPIVGAYGAYDAHVEHQGKRVDDPFAKVRIAEASSDIDAAWRQLSGNVA
DEYALLVAGEEVPFELRLRARRDQVRATGRAISSIDKLFESSGATALANGTPLQRFWRDAHAGRVHAANDPERAYVYGTG
EFGLPITDTV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rfqC03
FKAXSNLTAPGLERNTAPVYKXPWGTIHPTTISAPIVGXAYGAYDAHVEHQGKRVRAAFAGEKAKDDPFAKVRIAEASSD
IDAAWRQLSGNVADEYALLVAGEEVPFELRLRARRDQVRATGRAISSIDKLFESSGATALANGTPLQRFWRDAHAGRVHA
ANDPERAYVXYGTGEFGLPITDTXV
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 24 Jul 2008 17:49

Assigning to "1.20.140.10" based on similarity with "2rfqB03"

Flow stage update by auto on 24 Jul 2008 17:33

No in_process hits for Domain "2rfqC03" ready to be processed

Update comment by auto on 24 Jul 2008 17:17

Domain "2rfqC03" hits Domain "2rfqB03" (97.2972972972973% over 100%) which is currently in process

Update comment by auto on 23 Jul 2008 18:01

Domain "2rfqC03" hits Domain "2rfqA03" (97.2972972972973% over 100%) which is currently in process

Update comment by auto on 30 Nov 2007 10:36

Domain "2rfqC03" hits Domain "2rfqA03" (97.2972972972973% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2007 10:16

Domain "2rfqC03" hits Domain "2rfqA03" (97.2972972972973% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2007 10:16

NW result present for Domain "2rfqC03"

Flow stage update by auto on 24 Nov 2007 14:39

All required files are present for Domain "2rfqC03"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2rfqC03"

Insertion by auto on 23 Nov 2007 18:55

Final ChopClose added based on similarity with "2rfqA"