CATH Domain: 2rfqB01 XML data for domain: 2rfqB01

Molscript image for 2rfqB01
2rfqB01
PDB coordinates for domain 2rfqB01

PDB 2rfq, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.540 Butyryl-Coa Dehydrogenase, subunit A; domain 1
1.10.540.10 Butyryl-Coa Dehydrogenase, subunit A, domain 1 Gene3D
1.10.540.10.5
1.10.540.10.5.1
1.10.540.10.5.1.1
1.10.540.10.5.1.1.1
1.10.540.10.5.1.1.1.1

[top]
Segment boundaries for domain 2rfqB01

Chopping figure for domain 2rfqB01
DomainStart PDB ResidueStop PDB Residue
2rfqB01 3 111
2rfqB02 112 206
2rfqB03 207 391

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.540.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2or0B01 88.62 Rhodococcus jostii RHA1Hydroxylase 1.10.540.10 121 34 83 2.79 3.34
1bucA01 82.44 Acyl-CoA dehydrogenase, short-chain specificMegasphaera elsdenii 1.10.540.10 123 11 82 2.84 3.42
1r2jA01 82.22 Streptomyces hygroscopicus subsp. ascomyceticusFkbI 1.10.540.10 103 15 92 2.73 2.96
1ukwA01 81.34 Geraniol degradationThermus thermophilus HB27[EC:1.3.99.-]Putative acyl-CoA dehydrogenase1- and 2-Methylnaphthalene degradation 1.10.540.10 116 13 87 2.60 2.96
1siqA01 79.35 Fatty acid metabolismGlutaryl-CoA dehydrogenase [EC:1.3.99.7]Glutaryl-CoA dehydrogenase activityHomo sapiensGlutaryl-CoA dehydrogenase, mitochondrial 1.10.540.10 128 7 78 2.80 3.58
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rfqB01
DHDSHEVQRLDALLPTLRERAQETEDLRRIPDDSKALQETGFFRLLQPEQWGGYQADPVLFYSAVRKIASACGSTGWVSS
IIGVHNWHLALFSQQAQEDVWGNDTDV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rfqB01
QGHVGDHDSHEVXQRLDALLPTLRERAQETEDLRRIPDDSXKALQETGFFRLLQPEQWGGYQADPVLFYSAVRKIASACG
STGWVSSIIGVHNWHLALFSQQAQEDVWGNDTDV
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 21 Feb 2008 16:30

Assigning to "1.10.540.10" based on similarity with "2rfqA01"

Flow stage update by auto on 21 Feb 2008 16:29

No in_process hits for Domain "2rfqB01" ready to be processed

Update comment by auto on 21 Feb 2008 16:15

Domain "2rfqB01" hits Domain "2rfqA01" (98.2456140350877% over 100%) which is currently in process

Update comment by auto on 30 Nov 2007 10:36

Domain "2rfqB01" hits Domain "2or0A01" (37.1428571428571% over 92.1052631578947%) which is currently in process

Flow stage update by auto on 30 Nov 2007 10:16

Domain "2rfqB01" hits Domain "2or0A01" (37.1428571428571% over 92.1052631578947%) which is currently in process

Flow stage update by auto on 30 Nov 2007 10:16

NW result present for Domain "2rfqB01"

Flow stage update by auto on 24 Nov 2007 14:39

All required files are present for Domain "2rfqB01"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2rfqB01"

Insertion by auto on 23 Nov 2007 18:31

Final ChopClose added based on similarity with "2rfqA"