CATH Domain: 2rfqA02 XML data for domain: 2rfqA02

Molscript image for 2rfqA02
2rfqA02
PDB coordinates for domain 2rfqA02

PDB 2rfq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.110 Butyryl-CoA Dehydrogenase, subunit A; domain 2
2.40.110.10 Butyryl-CoA Dehydrogenase, subunit A, domain 2 Gene3D
2.40.110.10.3
2.40.110.10.3.1
2.40.110.10.3.1.1
2.40.110.10.3.1.1.1
2.40.110.10.3.1.1.1.1

[top]
Segment boundaries for domain 2rfqA02

Chopping figure for domain 2rfqA02
DomainStart PDB ResidueStop PDB Residue
2rfqA01 4 111
2rfqA02 112 206
2rfqA03 207 391

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.40.110.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1r2jA02 85.38 Streptomyces hygroscopicus subsp. ascomyceticusFkbI 2.40.110.10 106 18 83 1.92 2.29
1siqA02 84.30 Fatty acid metabolismGlutaryl-CoA dehydrogenase [EC:1.3.99.7]Glutaryl-CoA dehydrogenase activityHomo sapiensGlutaryl-CoA dehydrogenase, mitochondrial 2.40.110.10 107 17 83 1.84 2.21
2wbiA02 82.12 Homo sapiensAcyl-CoA dehydrogenase family member 11 2.40.110.10 117 20 79 2.58 3.25
2ddhA02 80.03 PeroxisomeFatty acid metabolismRattus norvegicusPPAR signaling pathwayPalmitoyl-CoA oxidase activity 2.40.110.10 133 12 69 2.04 2.92
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rfqA02
RISSSYAPGAGQVVDGGYTVNGAWAWSSGCDHASWAVLGGPVIKDGRPVDFVSFLIPREDYRIDDVWNVVGLRGTGSNTV
VVEDVFVPTHRVLS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rfqA02
RISSSYAPXGAGQVVDGGYTVNGAWAWSSGCDHASWAVLGGPVIKDGRPVDFVSFLIPREDYRIDDVWNVVGLRGTGSNT
VVVEDVFVPTHRVLS
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 21 Feb 2008 16:30

Assigning to "2.40.110.10" based on similarity with "2or0A02"

Flow stage update by auto on 21 Feb 2008 16:29

No in_process hits for Domain "2rfqA02" ready to be processed

Update comment by auto on 30 Nov 2007 10:36

Domain "2rfqA02" hits Domain "2or0A02" (47.3684210526316% over 95.959595959596%) which is currently in process

Flow stage update by auto on 30 Nov 2007 10:16

Domain "2rfqA02" hits Domain "2or0A02" (47.3684210526316% over 95.959595959596%) which is currently in process

Flow stage update by auto on 30 Nov 2007 10:16

NW result present for Domain "2rfqA02"

Flow stage update by auto on 24 Nov 2007 14:39

All required files are present for Domain "2rfqA02"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2rfqA02"

Insertion by auto on 23 Nov 2007 12:30

Final ChopClose added based on similarity with "2or0A"