CATH Domain: 2rflH00 XML data for domain: 2rflH00

Molscript image for 2rflH00
2rflH00
PDB coordinates for domain 2rflH00

PDB 2rfl, Chain H, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1240 Phosphoglycerate mutase-like Gene3D
3.40.50.1240.11
3.40.50.1240.11.1
3.40.50.1240.11.1.1
3.40.50.1240.11.1.1.1
3.40.50.1240.11.1.1.1.1

[top]
Segment boundaries for domain 2rflH00

Chopping figure for domain 2rflH00
DomainStart PDB ResidueStop PDB Residue
2rflH00 3 167

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2rflH00
ASFPTRVYLLRHAKAAWAAPGERDFDRGLNEAGFAEAEIIADLAADRRYRPDLILSSTAARCRQTTQAWQRAFIDIVYID
EYNARSETYLSLIAAQTEVQSVLVGHNPTEATLEAIGEDLLHAALPSGFPTSGLAVLDQDKNRWRLIDFLAP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rflH00
GHXTASFPTRVYLLRHAKAAWAAPGERDFDRGLNEAGFAEAEIIADLAADRRYRPDLILSSTAARCRQTTQAWQRAFNEG
IDIVYIDEXYNARSETYLSLIAAQTEVQSVXLVGHNPTXEATLEAXIGEDLLHAALPSGFPTSGLAVLDQDDSAASGKNR
WRLIDFLAPGKGS
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 21 Jan 2009 13:50

Assigning to "3.40.50.1240" based on similarity with "2rflA00"

Flow stage update by auto on 21 Jan 2009 13:47

No in_process hits for Domain "2rflH00" ready to be processed

Update comment by auto on 21 Jan 2009 13:45

Domain "2rflH00" hits Domain "2rflD00" (97.1098265895954% over 100%) which is currently in process

Update comment by auto on 21 Jan 2009 13:36

Domain "2rflH00" hits Domain "2rflB00" (97.1098265895954% over 100%) which is currently in process

Update comment by auto on 21 Jan 2009 13:30

Domain "2rflH00" hits Domain "2rflF00" (97.1098265895954% over 100%) which is currently in process

Update comment by auto on 21 Jan 2009 13:22

Domain "2rflH00" hits Domain "2rflG00" (97.1098265895954% over 100%) which is currently in process

Update comment by auto on 21 Jan 2009 13:12

Domain "2rflH00" hits Domain "2rflC00" (97.1098265895954% over 100%) which is currently in process

Update comment by auto on 21 Jan 2009 12:56

Domain "2rflH00" hits Domain "2rflE00" (97.1098265895954% over 100%) which is currently in process

Update comment by auto on 24 Sep 2008 11:19

Domain "2rflH00" hits Domain "2rflA00" (97.1098265895954% over 100%) which is currently in process

Flow stage update by auto on 24 Sep 2008 11:17

Domain "2rflH00" hits Domain "2rflA00" (97.1098265895954% over 100%) which is currently in process

Flow stage update by auto on 24 Sep 2008 11:17

NW result present for Domain "2rflH00"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2rflH00"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2rflH00"

Insertion by auto on 22 Sep 2008 14:15

Final ChopClose added based on similarity with "2rflA"