CATH Domain: 2rffA00

2rffA00

PDB 2rff, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.460	Beta Polymerase; domain 2
3.30.460.10	Beta Polymerase, domain 2	Gene3D
3.30.460.10.2
3.30.460.10.2.1
3.30.460.10.2.1.1
3.30.460.10.2.1.1.1
3.30.460.10.2.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2rffA00

Domain	Start PDB Residue	Stop PDB Residue
2rffA00	0	110

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.460.10.2.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1ylqA00	78.78	Archaeoglobus fulgidusPutative uncharacterized protein	3.30.460.10	92	15	79	3.38	4.27

[top]
Domain ATOM Sequence

>pdb|2rffA00
GGKGKSAIESQIRLKLAKEIVEEVASSFPNLEEVYIFGSRARGDYLDTSDIDILFVFKGIKENVFDRYVSRFIRGNVDYI
VLDEGEKDRVKDKVLFWKREKGFVLL

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2rffA00
GXGKGKSAIESQIRXLKLAKEIVEEVASSFPNLEEVYIFGSRARGDYLDTSDIDILFVFKGIKEXNVFDRXYXVSRFIRG
NVDYIVLDEGEKDRVKDKVLFWKREKGFVLL

BLAST against CATH

[top]
Domain History Events (101)

Domain assigned by cuff on 21 Jan 2009 12:51

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 12:50

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 12:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 12:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 11:56

Domain "2rffA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 11:56

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rffA00

Flow stage update by auto on 05 Nov 2008 11:52

Retrieved PRC_PFAMCATH results for job ID SID9539607099792252 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 11:51

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 13 results for 2rffA00

Update comment by auto on 05 Nov 2008 08:58

PRC_PFAMCATH job SID9539607099792252 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 08:53

The entry "2rffA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 08:53

The entry "2rffA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 08:45

Retrieved SSAP results for job ID SID0416443761150040 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 08:43

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1785 results for 2rffA00

Update comment by auto on 03 Nov 2008 17:49

SSAP job SID0416443761150040 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:38

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:38

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:34

Giving up on SSAP job SID4096609183548826 because submission time of Tue Oct 28 12:15:20 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:26 2008).

Update comment by auto on 28 Oct 2008 12:33

SSAP job SID4096609183548826 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:15

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:15

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:58

Giving up on SSAP job SID4883560131543360 because submission time of Wed Oct 22 09:28:26 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:58:54 2008).

Update comment by auto on 22 Oct 2008 09:44

SSAP job SID4883560131543360 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:28

The entry "2rffA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:28

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:22

Giving up on SSAP job SID5855405682858872 because submission time of Thu Oct 16 06:05:53 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:22:20 2008).

Update comment by auto on 16 Oct 2008 06:23

SSAP job SID5855405682858872 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:05

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:05

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:35

Giving up on SSAP job SID5261515227269472 because submission time of Fri Oct 10 03:08:36 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:35:22 2008).

Update comment by auto on 10 Oct 2008 03:44

SSAP job SID5261515227269472 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:08

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:08

The entry "2rffA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:57

Retrieved PRC results for job ID SID8454393041301856 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:56

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 2rffA00

Update comment by auto on 09 Oct 2008 04:01

PRC job SID8454393041301856 is not yet finished.

Prc cath submit by auto on 09 Oct 2008 03:38

The entry "2rffA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 03:38

The entry "2rffA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 03:29

Retrieved HMM(SAM) results for job ID SID0248893847438232 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 03:28

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 2rffA00