Domain assigned by cuff on 21 Jan 2009 12:43
homology check
CATH Domain: 2rf5A00
2rf5A00
PDB 2rf5, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2rf5A00 QGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLF HGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQF STIKMAHAPPGHHSVIGRPLAYAEYVIYRGEQAYPEYLITYQIMKPE
Domain History Events (101)
Domain assignment manual match h by cuff on 21 Jan 2009 12:40
same superfamily
Homcheck allotment by cuff on 21 Jan 2009 12:39
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 21 Jan 2009 12:39
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 06 Nov 2008 00:33
Domain "2rf5A00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 06 Nov 2008 00:32
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rf5A00
Flow stage update by auto on 06 Nov 2008 00:23
Retrieved PRC_PFAMCATH results for job ID SID2811140972617056 and results inserted.
Domain scan prc pfamcath by auto on 06 Nov 2008 00:22
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 2rf5A00
Update comment by auto on 05 Nov 2008 20:52
PRC_PFAMCATH job SID2811140972617056 is not yet finished.
Prc pfamcath submit by auto on 05 Nov 2008 20:49
The entry "2rf5A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 05 Nov 2008 20:49
The entry "2rf5A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 05 Nov 2008 20:23
Retrieved SSAP results for job ID SID4053834790539936 and results inserted.
Domain scan ssap cath by auto on 05 Nov 2008 20:22
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 46 results for 2rf5A00
Update comment by auto on 03 Nov 2008 17:49
SSAP job SID4053834790539936 is not yet finished.
Ssap cath submit by auto on 03 Nov 2008 17:38
The entry "2rf5A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 17:38
The entry "2rf5A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 14:34
Giving up on SSAP job SID4568113828386912 because submission time of Tue Oct 28 12:15:13 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:22 2008).
Update comment by auto on 28 Oct 2008 12:33
SSAP job SID4568113828386912 is not yet finished.
Flow stage update by auto on 28 Oct 2008 12:15
The entry "2rf5A00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 28 Oct 2008 12:15
The entry "2rf5A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 08:58
Giving up on SSAP job SID1054527726509920 because submission time of Wed Oct 22 09:28:19 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:58:50 2008).
Update comment by auto on 22 Oct 2008 09:44
SSAP job SID1054527726509920 is not yet finished.
Flow stage update by auto on 22 Oct 2008 09:28
The entry "2rf5A00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 22 Oct 2008 09:28
The entry "2rf5A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 06:22
Giving up on SSAP job SID9584737092867056 because submission time of Thu Oct 16 06:05:47 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:22:13 2008).
Update comment by auto on 16 Oct 2008 06:23
SSAP job SID9584737092867056 is not yet finished.
Ssap cath submit by auto on 16 Oct 2008 06:05
The entry "2rf5A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 06:05
The entry "2rf5A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 03:35
Giving up on SSAP job SID5464316017892020 because submission time of Fri Oct 10 03:08:27 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:35:16 2008).
Update comment by auto on 10 Oct 2008 03:44
SSAP job SID5464316017892020 is not yet finished.
Ssap cath submit by auto on 10 Oct 2008 03:08
The entry "2rf5A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 03:08
The entry "2rf5A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 01:56
Retrieved PRC results for job ID SID6974927912151136 and inserted them into the database.
Domain scan prc cath by auto on 10 Oct 2008 01:56
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2rf5A00
Update comment by auto on 08 Oct 2008 18:24
PRC job SID6974927912151136 is not yet finished.
Prc cath submit by auto on 08 Oct 2008 18:12
The entry "2rf5A00" has been submitted to the PRC webservice.
Flow stage update by auto on 08 Oct 2008 18:12
The entry "2rf5A00" has been submitted to the PRC webservice.
Flow stage update by auto on 08 Oct 2008 17:59
Retrieved HMM(SAM) results for job ID SID2380515918384640 and inserted them into the database.
Domain scan sam cath by auto on 08 Oct 2008 17:59
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2rf5A00
Update comment by auto on 03 Oct 2008 21:05
HMM(SAM) job SID2380515918384640 is not yet finished.
Sam cath submit by auto on 03 Oct 2008 20:47
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 20:47
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 18:04
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID7920921431544800"
Update comment by auto on 03 Oct 2008 00:39
HMM(SAM) job SID7920921431544800 is not yet finished.
Sam cath submit by auto on 03 Oct 2008 00:14
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 00:14
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 21:07
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID4517396435989040"
Update comment by auto on 02 Oct 2008 18:27
HMM(SAM) job SID4517396435989040 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 18:09
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 18:09
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 15:15
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID0026994694398848"
Update comment by auto on 02 Oct 2008 12:12
HMM(SAM) job SID0026994694398848 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 11:55
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 11:55
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 09:33
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID8729483726676672"
Update comment by auto on 01 Oct 2008 09:03
HMM(SAM) job SID8729483726676672 is not yet finished.
Sam cath submit by auto on 01 Oct 2008 08:56
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 01 Oct 2008 08:56
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 01 Oct 2008 06:17
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID6229525750551136"
Update comment by auto on 26 Sep 2008 17:54
HMM(SAM) job SID6229525750551136 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 17:48
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 17:48
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 14:54
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID5593230667564676"
Update comment by auto on 26 Sep 2008 12:27
HMM(SAM) job SID5593230667564676 is not yet finished.
Flow stage update by auto on 26 Sep 2008 12:19
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 26 Sep 2008 12:19
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 09:17
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID0894231616148912"
Update comment by auto on 26 Sep 2008 06:39
HMM(SAM) job SID0894231616148912 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 06:31
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 06:31
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 03:51
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID5687951482090200"
Update comment by auto on 26 Sep 2008 00:06
HMM(SAM) job SID5687951482090200 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 23:57
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 23:57
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 20:52
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID2174445645887344"
Update comment by auto on 25 Sep 2008 18:03
HMM(SAM) job SID2174445645887344 is not yet finished.
Flow stage update by auto on 25 Sep 2008 17:54
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 25 Sep 2008 17:54
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 14:59
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID2586790347168852"
Update comment by auto on 25 Sep 2008 12:36
HMM(SAM) job SID2586790347168852 is not yet finished.
Flow stage update by auto on 25 Sep 2008 12:24
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 25 Sep 2008 12:24
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 09:48
Unable to retrieve "2rf5A00" HMM(SAM) results for job "SID7541844014706400"
Update comment by auto on 25 Sep 2008 02:53
HMM(SAM) job SID7541844014706400 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 02:42
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 02:42
The entry "2rf5A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 01:57
Retrieved "2rf5A00" CATHEDRAL results for job ID SID0141246704450085 and inserted them into the database.
Domain scan cathedral cath by auto on 25 Sep 2008 01:56
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 166 results for 2rf5A00
Flow stage update by auto on 25 Sep 2008 00:11
The entry "2rf5A00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 25 Sep 2008 00:11
The entry "2rf5A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 24 Sep 2008 23:50
ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rf5A00.scanlist" for "2rf5A00"
Write scan list by auto on 24 Sep 2008 23:50
Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rf5A00.scanlist" for domain "2rf5A00"
Update comment by auto on 24 Sep 2008 21:15
Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 17:32
Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 12:06
Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.
Flow stage update by auto on 24 Sep 2008 11:36
No satisfactory AssignClose result found.
Flow stage update by auto on 24 Sep 2008 11:17
No in_process hits for Domain "2rf5A00" ready to be processed
Flow stage update by auto on 24 Sep 2008 11:17
NW result present for Domain "2rf5A00"
Flow stage update by auto on 23 Sep 2008 08:17
All required files are present for Domain "2rf5A00"
Flow stage update by auto on 22 Sep 2008 15:12
Beginning processing for Domain "2rf5A00"
Insertion by cuff on 22 Sep 2008 13:19
nice chopping
