CATH Domain: 2re2A00

2re2A00

PDB 2re2, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.420	Nucleotidyltransferase; domain 5
3.30.420.130		Gene3D
3.30.420.130.1
3.30.420.130.1.1
3.30.420.130.1.1.1
3.30.420.130.1.1.1.1
3.30.420.130.1.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2re2A00

Domain	Start PDB Residue	Stop PDB Residue
2re2A00	-3	114

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.420.130.1.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1o13A00	85.91	Thermotoga maritimaPutative uncharacterized protein	3.30.420.130	105	15	84	2.12	2.50
2qtdA00	84.90	Methanocaldococcus jannaschiiUncharacterized protein MJ0327	3.30.420.130	95	17	82	2.49	3.03
1rduA00	82.31	Thermotoga maritimaPutative uncharacterized protein	3.30.420.130	116	20	92	3.13	3.39

[top]
Domain ATOM Sequence

>pdb|2re2A00
YFQGKFAVAVSGDRVNGPGESEEVQIYETDGGNVRLIEKYSNPALNATAARGVFLKSALDHGANALVLSEIGSPGFNFIK
NKDVYIVPEPVADALKLILEGKVSPATAPTHDHG

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2re2A00
XGSDKIHHHHHHENLYFQGXKFAVAVSGDRVNGPGESEEVQIYETDGGNVRLIEKYSNPALNATAARGVFXLKSALDHGA
NALVLSEIGSPGFNFIKNKXDVYIVPEXPVADALKLILEGKVSPATAPTHDHGHHH

BLAST against CATH

[top]
Domain History Events (101)

Domain assigned by cuff on 21 Jan 2009 12:31

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 12:30

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 12:29

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 12:29

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 11:56

Domain "2re2A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 11:55

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2re2A00

Flow stage update by auto on 05 Nov 2008 11:51

Retrieved PRC_PFAMCATH results for job ID SID3624590297478056 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 11:51

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 114 results for 2re2A00

Update comment by auto on 05 Nov 2008 08:58

PRC_PFAMCATH job SID3624590297478056 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 08:53

The entry "2re2A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 08:53

The entry "2re2A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 08:43

Retrieved SSAP results for job ID SID2140192254565136 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 08:40

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1745 results for 2re2A00

Update comment by auto on 03 Nov 2008 17:49

SSAP job SID2140192254565136 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:37

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:37

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:34

Giving up on SSAP job SID8268939920994240 because submission time of Tue Oct 28 12:14:44 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:05 2008).

Update comment by auto on 28 Oct 2008 12:32

SSAP job SID8268939920994240 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:14

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:14

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:58

Giving up on SSAP job SID9744414741509568 because submission time of Wed Oct 22 09:27:45 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:58:28 2008).

Update comment by auto on 22 Oct 2008 09:44

SSAP job SID9744414741509568 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:27

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:27

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:21

Giving up on SSAP job SID4620334370834712 because submission time of Thu Oct 16 06:05:17 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:21:40 2008).

Update comment by auto on 16 Oct 2008 06:22

SSAP job SID4620334370834712 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:05

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:05

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:34

Giving up on SSAP job SID7859251115213304 because submission time of Fri Oct 10 03:07:55 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:34:57 2008).

Update comment by auto on 10 Oct 2008 03:44

SSAP job SID7859251115213304 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:07

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:07

The entry "2re2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:52

Retrieved PRC results for job ID SID1323590291565024 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:51

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 5 results for 2re2A00

Update comment by auto on 08 Oct 2008 18:24

PRC job SID1323590291565024 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 18:11

The entry "2re2A00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 18:11

The entry "2re2A00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 17:58

Retrieved HMM(SAM) results for job ID SID3173909049742988 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 17:57

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2re2A00