CATH Domain: 2rdeA02 XML data for domain: 2rdeA02

Molscript image for 2rdeA02
2rdeA02
PDB coordinates for domain 2rdeA02

PDB 2rde, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.10 Thrombin, subunit H
2.40.10.220 predicted glycosyltransferase like domains Gene3D
2.40.10.220.1
2.40.10.220.1.1
2.40.10.220.1.1.1
2.40.10.220.1.1.1.1
2.40.10.220.1.1.1.1.1

[top]
Segment boundaries for domain 2rdeA02

Chopping figure for domain 2rdeA02
DomainStart PDB ResidueStop PDB Residue
2rdeA01 24 136
2rdeA02 137 247

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2rdeA02
KEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHA
RYGLEFNEEGRNNAKNLLAQLKFNGTKLTLN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rdeA02
KEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHA
RYGLEFNEEGRNNAKNLLAQLKFNGTKLTLNAEKKA
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 20 Oct 2008 14:45

Assigning to "2.40.10.220" based on similarity with "2rdeB02"

Flow stage update by auto on 20 Oct 2008 14:43

No in_process hits for Domain "2rdeA02" ready to be processed

Update comment by auto on 20 Oct 2008 14:41

Domain "2rdeA02" hits Domain "2rdeB02" (100% over 100%) which is currently in process

Update comment by auto on 24 Sep 2008 08:26

Domain "2rdeA02" hits Domain "1ylnA02" (100% over 100%) which is currently in process

Flow stage update by auto on 24 Sep 2008 08:23

Domain "2rdeA02" hits Domain "1ylnA02" (100% over 100%) which is currently in process

Flow stage update by auto on 24 Sep 2008 08:23

NW result present for Domain "2rdeA02"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2rdeA02"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2rdeA02"

Insertion by cuff on 22 Sep 2008 12:05

nice chopping