CATH Domain: 2rccA01 XML data for domain: 2rccA01

Molscript image for 2rccA01
2rccA01
PDB coordinates for domain 2rccA01

PDB 2rcc, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.620 Ribonucleotide Reductase, subunit A
1.10.620.20 Ribonucleotide Reductase, subunit A Gene3D
1.10.620.20.9
1.10.620.20.9.1
1.10.620.20.9.1.1
1.10.620.20.9.1.1.1
1.10.620.20.9.1.1.1.1

[top]
Segment boundaries for domain 2rccA01

Chopping figure for domain 2rccA01
DomainStart PDB ResidueStop PDB Residue
2rccA01 38 296

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.620.20.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2oc5A01 75.49 Prochlorococcus marinus str. MIT 9313Putative uncharacterized protein 1.20.1260.10 203 8 77 3.45 4.43
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rccA01
SWAYPLYKNLANFWTPFEINSHDAKQFPTLTETEQEAFKKIIGLLAFLDSVQTDYSRAAEYLTDSSLAALSVLSFQEVVH
NQSYSYVLSSLVPKATQDEIFEYWKHDDVLKERNEFIIDGYEKFVDNPTPKTFLESIVYDVILEGLNFYSGFAFFYNLAR
NQKVSTSTINYINRDEQLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLKAADLEKDWFRYIIGDKIPGINPEDETYIS
FIANKRAVQLG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rccA01
SWAYPLYKNXLANFWTPFEINXSHDAKQFPTLTETEQEAFKKIIGLLAFLDSVQTDYSXRAAEYLTDSSLAALXSVLSFQ
EVVHNQSYSYVLSSLVPKATQDEIFEYWKHDDVLKERNEFIIDGYEKFVDNPTPKTFLESIVYDVILEGLNFYSGFAFFY
NLARNQKXVSTSTXINYINRDEQLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLXKAADLEKDWFRYIIGDKIPGINP
EDXETYISFIANKRAVQLG
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 21 Jan 2009 12:04

Assigning to "1.10.620.20" based on similarity with "2rccC01"

Flow stage update by auto on 21 Jan 2009 11:55

No in_process hits for Domain "2rccA01" ready to be processed

Update comment by auto on 21 Jan 2009 11:40

Domain "2rccA01" hits Domain "2rccB01" (96.9111969111969% over 100%) which is currently in process

Update comment by auto on 24 Sep 2008 08:26

Domain "2rccA01" hits Domain "2rccC01" (96.9111969111969% over 100%) which is currently in process

Flow stage update by auto on 24 Sep 2008 08:23

Domain "2rccA01" hits Domain "2rccC01" (96.9111969111969% over 100%) which is currently in process

Flow stage update by auto on 24 Sep 2008 08:23

NW result present for Domain "2rccA01"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2rccA01"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2rccA01"

Insertion by auto on 22 Sep 2008 14:05

Final ChopClose added based on similarity with "2rccC"