CATH Domain: 2rbdA01

2rbdA01

PDB 2rbd, Chain A, Domain 1

CATH Code	Level Description	Links
1	Mainly Alpha
1.20	Up-down Bundle
1.20.1260	Ferritin;
1.20.1260.10		Gene3D
1.20.1260.10.10
1.20.1260.10.10.1
1.20.1260.10.10.1.1
1.20.1260.10.10.1.1.1
1.20.1260.10.10.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2rbdA01

Domain	Start PDB Residue	Stop PDB Residue
2rbdA01	7	156

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.10.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1vlgA00	83.29	Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin	1.20.1260.10	164	7	79	3.64	4.56
	1wb7A01	71.60	Superoxide dismutase, Fe-Mn family [EC:1.15.1.1]Sulfolobus solfataricusSuperoxide dismutase [Fe]	1.10.287.990	67	4	40	2.04	4.99

[top]
Domain ATOM Sequence

>pdb|2rbdA01
NPQDEPLHYGEVFSTWTYLSTNNGLINGYRSFINHTGDEDLKNLIDEAIQAQDENHQLEELLRSNGVGLPPAPPDRPAAR
LDDIPVGARFNDPEISATISDVAKGLVTCSQIIGQSIREDVALFSQFHAKVQFGGKLKLNKNKGW

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2rbdA01
GXGILSGNPQDEPLHYGEVFSTWTYLSTNNGLINGYRSFINHTGDEDLKNLIDEAIQAXQDENHQLEELLRSNGVGLPPA
PPDRPAARLDDIPVGARFNDPEISATISXDVAKGLVTCSQIIGQSIREDVALXFSQFHXAKVQFGGKXLKLNKNKGW

BLAST against CATH

[top]
Domain History Events (102)

Domain assigned by cuff on 21 Jan 2009 10:58

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 10:56

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 10:53

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 10:53

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 11:54

Domain "2rbdA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 11:54

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rbdA01

Flow stage update by auto on 05 Nov 2008 11:49

Retrieved PRC_PFAMCATH results for job ID SID3901185520818156 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 11:49

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 4 results for 2rbdA01

Update comment by auto on 05 Nov 2008 08:57

PRC_PFAMCATH job SID3901185520818156 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 08:53

The entry "2rbdA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 08:53

The entry "2rbdA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 08:35

Retrieved SSAP results for job ID SID0201081558575776 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 08:31

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1674 results for 2rbdA01

Update comment by auto on 03 Nov 2008 17:48

SSAP job SID0201081558575776 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:36

The entry "2rbdA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:36

The entry "2rbdA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:33

Giving up on SSAP job SID4104421517822892 because submission time of Tue Oct 28 12:13:14 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:33:07 2008).

Update comment by auto on 28 Oct 2008 12:32

SSAP job SID4104421517822892 is not yet finished.

Flow stage update by auto on 28 Oct 2008 12:13

The entry "2rbdA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Oct 2008 12:13

The entry "2rbdA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:57

Giving up on SSAP job SID4873494795158624 because submission time of Wed Oct 22 09:26:27 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:57:41 2008).

Update comment by auto on 22 Oct 2008 09:43

SSAP job SID4873494795158624 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:26

The entry "2rbdA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:26

The entry "2rbdA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:20

Giving up on SSAP job SID3478785109486768 because submission time of Thu Oct 16 06:04:16 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:20:28 2008).

Update comment by auto on 16 Oct 2008 06:21

SSAP job SID3478785109486768 is not yet finished.

Flow stage update by auto on 16 Oct 2008 06:04

The entry "2rbdA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Oct 2008 06:04

The entry "2rbdA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:33

Giving up on SSAP job SID7123364626361160 because submission time of Fri Oct 10 03:05:36 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:33:34 2008).

Update comment by auto on 10 Oct 2008 03:42

SSAP job SID7123364626361160 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:05

The entry "2rbdA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:05

The entry "2rbdA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:44

Retrieved PRC results for job ID SID0950383491592944 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:43

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2rbdA01

Update comment by auto on 08 Oct 2008 18:23

PRC job SID0950383491592944 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 18:09

The entry "2rbdA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 18:09

The entry "2rbdA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 17:51

Retrieved HMM(SAM) results for job ID SID2792120867822280 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 17:51

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2rbdA01