Domain assigned by cuff on 23 Mar 2009 16:47
same superfamily
There are 13 matching structural neighberhood comparisons for CATH ID 3.40.1190.20.6.1.1.1.1 (SIMAX score < 5)
>pdb|2rbcA00 GGKHVLCVGAAVLDTLFRVADPKGEGKVLPYEVLQIAEGASSAAYAVHRGGRASLWGAVGDDETGTRILRDLSESGIDTS GTVAPGARSALSTIIIDNRGERLIVPFYDHRLHEKKRACTPEDIALFDAVLVDVRWPELALDVLTVARALGKPAILDGDV APVETLEGLAPAATHIVFSEPAATRLTGLETVKDLPVLHARYPQTFIAVTAGPAGCWWTEADDPTVHFQTTQVEAVDTLA AGDIFHGTFALAAEGQSRAAVRLSSVAAALKCTVFGGRIGAPTREETEEARQWLERE
>pdb|2rbcA00 GGKHVLCVGAAVLDTLFRVADXPKGEGKVLPYEVLQIAEGXASSAAYAVHRXGGRASLWGAVGDDETGTRILRDLSESGI DTSGXTVAPGARSALSTIIIDNRGERLIVPFYDHRLHEKKRACTPEDIALFDAVLVDVRWPELALDVLTVARALGKPAIL DGDVAPVETLEGLAPAATHIVFSEPAATRLTGLETVKDXLPVLHARYPQTFIAVTAGPAGCWWTEADDPTVHFQTTXQVE AVDTLAAGDIFHGTFALAXAEGXQSRAAVRLSSVAAALKCTVFGGRIGAPTREETEEAXRQWLERESEPALRASGS
same superfamily
same superfamily
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2rbcA00" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rbcA00
Retrieved PRC_PFAMCATH results for job ID SID4235650907802112 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 45 results for 2rbcA00
The entry "2rbcA00" has been submitted to the PRC_PFAMCATH webservice.
The entry "2rbcA00" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID5401446167116448 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 932 results for 2rbcA00
SSAP job SID5401446167116448 is not yet finished.
The entry "2rbcA00" has been submitted to the SSAP webservice.
The entry "2rbcA00" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID1638534482112560 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 23 results for 2rbcA00
PRC job SID1638534482112560 is not yet finished.
The entry "2rbcA00" has been submitted to the PRC webservice.
The entry "2rbcA00" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID6872350300680224 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 17 results for 2rbcA00
HMM(SAM) job SID6872350300680224 is not yet finished.
The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.
The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rbcA00" HMM(SAM) results for job "SID9716397374767344"
HMM(SAM) job SID9716397374767344 is not yet finished.
The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.
The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rbcA00" HMM(SAM) results for job "SID7461916652824288"
The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.
The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rbcA00" HMM(SAM) results for job "SID3728196348731904"
The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.
The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.
Retrieved "2rbcA00" CATHEDRAL results for job ID SID9551041784919012 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 483 results for 2rbcA00
"2rbcA00" CATHEDRAL job SID9551041784919012 is not yet finished.
The entry "2rbcA00" has been submitted to the CATHEDRAL webservice.
The entry "2rbcA00" has been submitted to the CATHEDRAL webservice.
Unable to retrieve "2rbcA00" CATHEDRAL results for job "SID9751912996908208"
"2rbcA00" CATHEDRAL job SID9751912996908208 is not yet finished.
The entry "2rbcA00" has been submitted to the CATHEDRAL webservice.
The entry "2rbcA00" has been submitted to the CATHEDRAL webservice.
ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rbcA00.scanlist" for "2rbcA00"
Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rbcA00.scanlist" for domain "2rbcA00"
Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.
Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.
Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.
Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.
Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.
Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.
Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.
Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.
Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.
Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.
Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2rbcA00" ready to be processed
NW result present for Domain "2rbcA00"
All required files are present for Domain "2rbcA00"
Beginning processing for Domain "2rbcA00"