CATH Domain: 2rbcA00 XML data for domain: 2rbcA00

Molscript image for 2rbcA00
2rbcA00
PDB coordinates for domain 2rbcA00

PDB 2rbc, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1190 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase
3.40.1190.20 Gene3D
3.40.1190.20.6
3.40.1190.20.6.1
3.40.1190.20.6.1.1
3.40.1190.20.6.1.1.1
3.40.1190.20.6.1.1.1.1

Segment boundaries for domain 2rbcA00

Chopping figure for domain 2rbcA00
DomainStart PDB ResidueStop PDB Residue
2rbcA00 6 311

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.40.1190.20.6.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rkdA00 86.40 Pentose phosphate pathwayD-ribose catabolic processRibokinase activityRibokinaseRibokinase [EC:2.7.1.15] 3.40.1190.20 306 23 94 2.51 2.65
2fv7A00 86.05 Pentose phosphate pathwayRibokinaseRibokinase [EC:2.7.1.15]Homo sapiens 3.40.1190.20 308 21 94 2.90 3.08
1tyyB00 84.24 Amino sugar and nucleotide sugar metabolismStarch and sucrose metabolismFructose and mannose metabolismMetabolic pathwaysFructokinase [EC:2.7.1.4] 3.40.1190.20 292 15 89 2.79 3.10
1v1aA00 84.06 Thermus thermophilus HB82-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose and glucuronate interconversionsPentose phosphate pathway2-keto-3-deoxy-gluconate kinase 3.40.1190.20 301 19 92 2.80 3.04
2abqA00 83.21 Fructose 1-phosphate kinase1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismBacillus halodurans 3.40.1190.20 302 16 91 2.70 2.95
2afbB00 82.29 Thermotoga maritima2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose phosphate pathwayPentose and glucuronate interconversions2-keto-3-deoxygluconate kinase 3.40.1190.20 319 15 87 2.79 3.19
2qcvA01 81.74 5-dehydro-2-deoxygluconokinase [EC:2.7.1.92]Bacillus haloduransInositol phosphate metabolismMetabolic pathways5-dehydro-2-deoxygluconokinase 3.40.1190.20 262 15 81 2.77 3.40
2nwhA00 81.64 Agrobacterium tumefaciens str. C58Carbohydrate kinase 3.40.1190.20 303 21 92 3.69 3.99
1vk4A00 80.85 Thermotoga maritimaPutative uncharacterized protein 3.40.1190.20 276 10 83 3.28 3.91
2ajrA01 78.76 Thermotoga maritima1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismSugar kinase, pfkB family 3.40.1190.20 259 13 78 3.24 4.11
2i5bA00 78.57 Thiamine metabolismBacillus subtilisPyridoxine kinasePhosphomethylpyrimidine kinase [EC:2.7.4.7]Metabolic pathways 3.40.1190.20 269 13 76 3.16 4.12
1ub0A00 77.64 TransferaseThiamine metabolismHydroxymethylpyrimidine kinase [EC:2.7.1.49]Phosphomethylpyrimidine kinase [EC:2.7.4.7]Metabolic pathways 3.40.1190.20 246 13 73 2.88 3.92
3bf5A01 76.77 Pentose phosphate pathwayRibokinase [EC:2.7.1.15]Thermoplasma acidophilumRibokinase related protein 3.40.1190.20 221 17 72 3.40 4.72
Displaying entries 1 to 13 (page 1 of 1)


Domain ATOM Sequence

>pdb|2rbcA00
GGKHVLCVGAAVLDTLFRVADPKGEGKVLPYEVLQIAEGASSAAYAVHRGGRASLWGAVGDDETGTRILRDLSESGIDTS
GTVAPGARSALSTIIIDNRGERLIVPFYDHRLHEKKRACTPEDIALFDAVLVDVRWPELALDVLTVARALGKPAILDGDV
APVETLEGLAPAATHIVFSEPAATRLTGLETVKDLPVLHARYPQTFIAVTAGPAGCWWTEADDPTVHFQTTQVEAVDTLA
AGDIFHGTFALAAEGQSRAAVRLSSVAAALKCTVFGGRIGAPTREETEEARQWLERE    

Domain COMBS Sequence

>pdb|2rbcA00
GGKHVLCVGAAVLDTLFRVADXPKGEGKVLPYEVLQIAEGXASSAAYAVHRXGGRASLWGAVGDDETGTRILRDLSESGI
DTSGXTVAPGARSALSTIIIDNRGERLIVPFYDHRLHEKKRACTPEDIALFDAVLVDVRWPELALDVLTVARALGKPAIL
DGDVAPVETLEGLAPAATHIVFSEPAATRLTGLETVKDXLPVLHARYPQTFIAVTAGPAGCWWTEADDPTVHFQTTXQVE
AVDTLAAGDIFHGTFALAXAEGXQSRAAVRLSSVAAALKCTVFGGRIGAPTREETEEAXRQWLERESEPALRASGS    

Domain History Events (70)

Domain assigned by cuff on 23 Mar 2009 16:47

same superfamily

Domain assignment manual match h by cuff on 23 Mar 2009 16:41

same superfamily

Homcheck allotment by cuff on 23 Mar 2009 16:36

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 23 Mar 2009 16:36

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 16 Mar 2009 18:43

Domain "2rbcA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 16 Mar 2009 18:42

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rbcA00

Flow stage update by auto on 16 Mar 2009 18:33

Retrieved PRC_PFAMCATH results for job ID SID4235650907802112 and results inserted.

Domain scan prc pfamcath by auto on 16 Mar 2009 18:33

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 45 results for 2rbcA00

Flow stage update by auto on 16 Mar 2009 18:29

The entry "2rbcA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 16 Mar 2009 18:29

The entry "2rbcA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Mar 2009 18:15

Retrieved SSAP results for job ID SID5401446167116448 and results inserted.

Domain scan ssap cath by auto on 16 Mar 2009 18:13

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 932 results for 2rbcA00

Update comment by auto on 10 Mar 2009 02:34

SSAP job SID5401446167116448 is not yet finished.

Ssap cath submit by auto on 10 Mar 2009 02:22

The entry "2rbcA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Mar 2009 02:22

The entry "2rbcA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Mar 2009 01:44

Retrieved PRC results for job ID SID1638534482112560 and inserted them into the database.

Domain scan prc cath by auto on 10 Mar 2009 01:43

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 23 results for 2rbcA00

Update comment by auto on 09 Mar 2009 19:59

PRC job SID1638534482112560 is not yet finished.

Flow stage update by auto on 09 Mar 2009 19:44

The entry "2rbcA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Mar 2009 19:44

The entry "2rbcA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 19:03

Retrieved HMM(SAM) results for job ID SID6872350300680224 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 19:02

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 17 results for 2rbcA00

Update comment by auto on 04 Mar 2009 16:10

HMM(SAM) job SID6872350300680224 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 16:00

The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 16:00

The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 12:38

Unable to retrieve "2rbcA00" HMM(SAM) results for job "SID9716397374767344"

Update comment by auto on 04 Mar 2009 04:13

HMM(SAM) job SID9716397374767344 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 04:01

The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 04:01

The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 00:52

Unable to retrieve "2rbcA00" HMM(SAM) results for job "SID7461916652824288"

Flow stage update by auto on 03 Mar 2009 23:31

The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Mar 2009 23:31

The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:53

Unable to retrieve "2rbcA00" HMM(SAM) results for job "SID3728196348731904"

Sam cath submit by auto on 19 Feb 2009 15:19

The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:19

The entry "2rbcA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 12:44

Retrieved "2rbcA00" CATHEDRAL results for job ID SID9551041784919012 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 12:43

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 483 results for 2rbcA00

Update comment by auto on 19 Feb 2009 07:34

"2rbcA00" CATHEDRAL job SID9551041784919012 is not yet finished.

Flow stage update by auto on 19 Feb 2009 06:21

The entry "2rbcA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 19 Feb 2009 06:21

The entry "2rbcA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 11:58

Unable to retrieve "2rbcA00" CATHEDRAL results for job "SID9751912996908208"

Update comment by auto on 22 Jan 2009 17:08

"2rbcA00" CATHEDRAL job SID9751912996908208 is not yet finished.

Cathedral cath submit by auto on 22 Jan 2009 16:36

The entry "2rbcA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2009 16:36

The entry "2rbcA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 14:57

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rbcA00.scanlist" for "2rbcA00"

Write scan list by auto on 21 Dec 2008 14:57

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rbcA00.scanlist" for domain "2rbcA00"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:42

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:36

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:35

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:50

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:58

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:49

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:42

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:55

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:34

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:33

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:38

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:52

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:47

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:25

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Flow stage update by auto on 17 Dec 2008 04:24

No satisfactory AssignClose result found.

Flow stage update by auto on 17 Dec 2008 02:51

No in_process hits for Domain "2rbcA00" ready to be processed

Flow stage update by auto on 17 Dec 2008 02:51

NW result present for Domain "2rbcA00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2rbcA00"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2rbcA00"

Insertion by cuff on 09 Dec 2008 15:08

WCD