CATH Domain: 2rb7A02 XML data for domain: 2rb7A02

Molscript image for 2rb7A02
2rb7A02
PDB coordinates for domain 2rb7A02

PDB 2rb7, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.360 Gene3D
3.30.70.360.2
3.30.70.360.2.1
3.30.70.360.2.1.1
3.30.70.360.2.1.1.1
3.30.70.360.2.1.1.1.1

[top]
Segment boundaries for domain 2rb7A02

Chopping figure for domain 2rb7A02
DomainStart PDB ResidueStop PDB Residue
2rb7A01 0 173
2rb7A01 281 359
2rb7A02 174 280

Structural Neighbourhood (26 entries)

There are 26 matching structural neighberhood comparisons for CATH ID 3.30.70.360.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 26 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ct9A02 87.75 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.30.70.360 104 30 90 2.58 2.85
1cg2A02 87.27 Pseudomonas sp. RS-16Carboxypeptidase G2 3.30.70.360 110 25 86 2.10 2.43
1vgyA02 85.92 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.30.70.360 114 21 85 2.23 2.59
2v8hA02 85.69 Beta-alanine synthaseLachancea kluyveri 3.30.70.360 116 14 80 2.24 2.79
1xmbA02 81.47 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.30.70.360 101 14 82 3.13 3.81
1j27A00 81.44 Hypothetical proteinThermus thermophilusPutative uncharacterized protein 3.30.70.1120 98 8 77 3.04 3.92
1lfwA02 81.02 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.30.70.360 106 12 84 3.78 4.45
1q5yD00 78.86 CopG family transcriptional regulator, nickel-responsive regulatorNickel-responsive regulatorProtein bindingEscherichia coli K-12 3.30.70.1150 80 7 71 3.16 4.42
2pokA02 78.65 Lysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Peptidase, M20/M25/M40 familyStreptococcus pneumoniae 3.30.70.360 170 17 57 2.54 4.41
1z2lA02 78.31 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.30.70.360 115 16 81 4.01 4.91
2j8sA07 78.18 Hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 familyAcriflavine resistance protein BProtein bindingEscherichia coli K-12 3.30.70.1440 94 7 83 4.07 4.86
2pd1A01 77.35 Nitrosomonas europaeaPutative uncharacterized protein 3.30.70.900 93 8 80 3.45 4.28
1s99A01 77.10 Bacillus subtilisPutative HMP/thiamine-binding protein ykoF 3.30.70.930 77 7 67 2.47 3.67
2nzcA00 76.93 Thermotoga maritimaPutative uncharacterized protein 3.30.70.1150 77 9 73 3.46 4.71
2iboA00 76.51 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.930 87 5 67 2.79 4.14
1x7vC00 76.49 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.70.900 97 8 80 3.71 4.60
1yqhB00 76.46 IG hypothetical 16092Bacillus cereus ATCC 14579 3.30.70.930 98 5 65 2.64 4.04
2fb0A00 76.23 Bacteroides thetaiotaomicronPutative uncharacterized protein 3.30.70.900 91 7 76 3.48 4.55
1vk8A00 76.20 Thermotoga maritimaPutative uncharacterized protein 3.30.70.930 91 4 68 2.92 4.27
2x3dF01 76.06 Hypothetical proteinSulfolobus solfataricusPutative uncharacterized protein 3.30.70.1340 84 9 76 3.05 3.99
2epiB00 75.88 Methanocaldococcus jannaschiiUPF0045 protein MJ1052 3.30.70.930 96 6 69 3.17 4.57
1lxjA00 75.56 CytoplasmNucleusSaccharomyces cerevisiaeUPF0045 protein ECM15Fungal-type cell wall organization 3.30.70.930 101 9 66 3.17 4.78
1q8bA00 75.17 Bacillus subtilisUncharacterized protein yjcS 3.30.70.900 89 8 81 3.87 4.74
1vr6A01 75.15 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysThermotoga maritima3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]Phospho-2-dehydro-3-deoxyheptonate aldolase 3.30.70.1140 75 9 70 2.95 4.19
1lfwA03 75.13 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.30.70.360 88 4 63 2.74 4.33
2od4B01 74.81 3.30.70.900 81 4 75 3.68 4.87
[1]
Displaying entries 1 to 26 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2rb7A02
KGIIDIKLTCTGKAAHGARPWGVNAVDLLEDYTRLKTLFAEENEDHWHRTVNLGRIRAGESTNKVPDVAEGWFNIRVTEH
DDPGALIDKIRKTVSGTVSIVRTVP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2rb7A02
KGIIDIKLTCTGKAAHGARPWXGVNAVDLLXEDYTRLKTLFAEENEDHWHRTVNLGRIRAGESTNKVPDVAEGWFNIRVT
EHDDPGALIDKIRKTVSGTVSIVRTVP
BLAST against CATH

[top]
Domain History Events (102)

Domain assigned by cuff on 21 Jan 2009 10:50

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 10:48

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 10:47

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 10:47

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 04:51

Domain "2rb7A02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 04:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rb7A02

Flow stage update by auto on 05 Nov 2008 04:46

Retrieved PRC_PFAMCATH results for job ID SID0503324051015416 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 04:45

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 14 results for 2rb7A02

Update comment by auto on 05 Nov 2008 00:05

PRC_PFAMCATH job SID0503324051015416 is not yet finished.

Flow stage update by auto on 05 Nov 2008 00:00

The entry "2rb7A02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 05 Nov 2008 00:00

The entry "2rb7A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 04 Nov 2008 23:50

Retrieved SSAP results for job ID SID6281138646098792 and results inserted.

Domain scan ssap cath by auto on 04 Nov 2008 23:47

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2964 results for 2rb7A02

Update comment by auto on 03 Nov 2008 17:48

SSAP job SID6281138646098792 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:36

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:36

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:33

Giving up on SSAP job SID1182517541411808 because submission time of Tue Oct 28 12:13:08 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:33:03 2008).

Update comment by auto on 28 Oct 2008 12:31

SSAP job SID1182517541411808 is not yet finished.

Flow stage update by auto on 28 Oct 2008 12:13

The entry "2rb7A02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Oct 2008 12:13

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:57

Giving up on SSAP job SID2515646640267440 because submission time of Wed Oct 22 09:26:20 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:57:37 2008).

Update comment by auto on 22 Oct 2008 09:43

SSAP job SID2515646640267440 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:26

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:26

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:20

Giving up on SSAP job SID1700909342207680 because submission time of Thu Oct 16 06:04:11 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:20:22 2008).

Update comment by auto on 16 Oct 2008 06:21

SSAP job SID1700909342207680 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:04

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:04

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:33

Giving up on SSAP job SID4177430758296272 because submission time of Fri Oct 10 03:05:27 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:33:26 2008).

Update comment by auto on 10 Oct 2008 03:42

SSAP job SID4177430758296272 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:05

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:05

The entry "2rb7A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:42

Retrieved PRC results for job ID SID4522748952031104 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:41

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 14 results for 2rb7A02

Update comment by auto on 08 Oct 2008 18:22

PRC job SID4522748952031104 is not yet finished.

Flow stage update by auto on 08 Oct 2008 18:09

The entry "2rb7A02" has been submitted to the PRC webservice.

Prc cath submit by auto on 08 Oct 2008 18:09

The entry "2rb7A02" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 17:51

Retrieved HMM(SAM) results for job ID SID4807770744044456 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 17:50

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 11 results for 2rb7A02

Update comment by auto on 03 Oct 2008 21:03

HMM(SAM) job SID4807770744044456 is not yet finished.

Flow stage update by auto on 03 Oct 2008 20:45

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 20:45

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 18:02

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID7253367537696848"

Update comment by auto on 03 Oct 2008 00:37

HMM(SAM) job SID7253367537696848 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 00:11

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:11

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 21:05

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID3342785199748768"

Update comment by auto on 02 Oct 2008 18:25

HMM(SAM) job SID3342785199748768 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 18:07

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:07

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 15:13

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID6530633630762991"

Update comment by auto on 02 Oct 2008 12:11

HMM(SAM) job SID6530633630762991 is not yet finished.

Flow stage update by auto on 02 Oct 2008 11:53

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 11:53

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 09:31

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID0648071628998130"

Update comment by auto on 01 Oct 2008 06:15

HMM(SAM) job SID0648071628998130 is not yet finished.

Flow stage update by auto on 01 Oct 2008 06:09

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 01 Oct 2008 06:09

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 01 Oct 2008 03:18

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID7332872891817144"

Update comment by auto on 26 Sep 2008 17:53

HMM(SAM) job SID7332872891817144 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 17:46

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 17:46

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 14:52

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID2842681271806954"

Update comment by auto on 26 Sep 2008 12:25

HMM(SAM) job SID2842681271806954 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 12:16

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 12:16

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 09:15

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID3941848318598784"

Update comment by auto on 26 Sep 2008 06:37

HMM(SAM) job SID3941848318598784 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 06:28

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 06:28

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 03:49

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID7265850576692352"

Update comment by auto on 26 Sep 2008 00:04

HMM(SAM) job SID7265850576692352 is not yet finished.

Flow stage update by auto on 25 Sep 2008 23:54

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 25 Sep 2008 23:54

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 20:50

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID8217824338444088"

Update comment by auto on 25 Sep 2008 18:02

HMM(SAM) job SID8217824338444088 is not yet finished.

Flow stage update by auto on 25 Sep 2008 17:52

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 25 Sep 2008 17:52

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 14:57

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID4231545533057344"

Update comment by auto on 25 Sep 2008 12:34

HMM(SAM) job SID4231545533057344 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 12:22

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 12:22

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 09:46

Unable to retrieve "2rb7A02" HMM(SAM) results for job "SID7746387337183544"

Update comment by auto on 25 Sep 2008 02:51

HMM(SAM) job SID7746387337183544 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 02:40

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 02:40

The entry "2rb7A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 01:39

Retrieved "2rb7A02" CATHEDRAL results for job ID SID3743483060863504 and inserted them into the database.

Domain scan cathedral cath by auto on 25 Sep 2008 01:38

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 236 results for 2rb7A02

Flow stage update by auto on 25 Sep 2008 00:08

The entry "2rb7A02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 25 Sep 2008 00:08

The entry "2rb7A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 Sep 2008 23:46

ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rb7A02.scanlist" for "2rb7A02"

Write scan list by auto on 24 Sep 2008 23:46

Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rb7A02.scanlist" for domain "2rb7A02"

Update comment by auto on 24 Sep 2008 21:15

Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 17:32

Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 12:06

Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 08:51

Waiting for 181 new domains (example : 2rdsA00) to be processed so that they can be scanned against too.

Flow stage update by auto on 24 Sep 2008 08:49

No satisfactory AssignClose result found.

Flow stage update by auto on 24 Sep 2008 08:23

No in_process hits for Domain "2rb7A02" ready to be processed

Flow stage update by auto on 24 Sep 2008 08:23

NW result present for Domain "2rb7A02"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2rb7A02"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2rb7A02"

Insertion by cuff on 22 Sep 2008 12:06

nice chopping